Pay in installments of $62.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD7 His Tag Protein, MouseProduct Specification Species Mouse Antigen CD7 Synonyms CD7, GP40, TP41, LEU 9, Tp40 Accession P50283 Amino Acid Sequence Gln24 Pro150, with C terminal 8*His QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 25kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance
Product Specification
| Species | Mouse |
| Antigen | CD7 |
| Synonyms | CD7, GP40, TP41, LEU-9, Tp40 |
| Accession | P50283 |
| Amino Acid Sequence | Gln24-Pro150, with C-terminal 8*His QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFPGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 20-25kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Sempowski G D. et al. (1999) Resistance of CD7-deficient mice to lipopolysaccharide-induced shock syndromes. J Exp Med. 189(6): 1011-1016. |
Background
CD7 is a 40-kD member of the Ig gene superfamily that is expressed on a major subset of human peripheral T lymphocytes and NK cells. CD7 is an early T cell activation antigen in that CD7 mRNA levels rise within 15 min after initiation of a transmembrane calcium ion flux. CD7 can complex with CD3 and CD45 molecules, and CD7 signaling involves both protein kinase C and protein tyrosine kinase. CD7 has been shown to be a functional signal-transducing molecule on resting NK cells. Antibody cross-linking of NK cell CD7 induced increases in free cytoplasmic calcium, secretion of IFN-γ, NK cell proliferation, adhesion to fibronectin, and NK cytotoxic activity. Although the above studies have demonstrated in vitro roles for CD7 in T and NK cell activation and/or adhesion, relevant functions of CD7 in vivo remain unknown.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy