Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 11 - Sep 16
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD62L , His tagProduct Specification Species Human Synonyms L selectin, Leukocyte adhesion molecule 1 (LAM 1), Leukocyte surface antigen Leu 8, Leukocyte endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90 MEL, SELL, LNHR, LYAM1 Accession P14151 Amino Acid Sequence Protein sequence(P14151, Trp39 Asn332, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | L-selectin, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90-MEL, SELL, LNHR, LYAM1 |
| Accession | P14151 |
| Amino Acid Sequence | Protein sequence(P14151, Trp39-Asn332, with C-10*His) WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:34.7kDa Actual:50-70kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
L-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. These tethering interactions are essential for the trafficking of monocytes and neutrophils into inflamed tissue as well as the homing of lymphocytes to secondary lymphoid organs. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. In addition to its function in the immune response, L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 13 reviews
Sort
Product Reviews
★★★★★ 4
Good for the price
Color: Ivory
They are very nice pots and pans. The handle is weird to get use to. Good for the price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
★★★★★ 5
Wowed by the quality and utility of the set!
Color: Ivory
Love the detachable handle, thoughtful lids, as well as the Tupperware style storage lids. These will be easy to clean in the dishwasher or sink. They are lighter weight than my other ceramic pans which I appreciate
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
★★★★★ 5
Great Cookware Set
Color: Linen Gray
It features a simple combination of various cooking functions, and I like its moveable handle, which saves space when storing. The price is also reasonable, so I recommend you buy one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
★★★★★ 5
they are gorgeous and functional
Color: Ivory
we got these with our cooktop and it is great value and super easy to clean goes in my dishwasher and love how it cooks and cleans they are perfect and gorgeous in white we been using them on the electric stove and they still look brand new. and they cook everything perfectly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
★★★★★ 5
A great cooking set for just about any meal.
Size: 11-Piece Set
This is a great set of cookware at a very reasonable price. I was looking to make the switch from using non-stick coating to something more natural to minimize the risk of potential toxins. This stainless steel cook set comes with everything that you need to cook just about any meal. As with any stainless cook set, it does require a different approach to cooking, but it's a good tradeoff to know that you're using steel instead of non-stick coating. The quality feels very sturdy, and I feel like these will last me a long time. They are very easy to clean if you soak and use something like bar keeper's friend for anything that is stuck.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026