SKU: 68415478494

Mouse CXCL10/IP-10/CRG-2 Protein

Sale price$123.75 Regular price$137.50
Save 10%

Pay in installments of $34.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CXCL10/IP-10/CRG-2 ProteinProduct Specification Species Mouse Synonyms C X C motif chemokine 10, 10 kDa interferon gamma induced protein (Gamma IP10; IP 10), C7, Interferon gamma induced protein CRG 2, Small inducible cytokine B10, Crg2, Ifi10, Inp10, Scyb10 Accession P17515 Amino Acid Sequence Protein sequence (P17515, Ile22 Pro98) IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP Expression System HEK293 Molecular Weight Predicted MW: 8. 7 kDa

Product Specification


Species Mouse
Synonyms C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein (Gamma-IP10; IP-10), C7, Interferon-gamma induced protein CRG-2, Small-inducible cytokine B10, Crg2, Ifi10, Inp10, Scyb10
Accession P17515
Amino Acid Sequence

Protein sequence (P17515, Ile22-Pro98) IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

Expression System HEK293
Molecular Weight Predicted MW: 8.7 kDa Observed MW: 10 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

C-X-C motif chemokine 10 is a small cytokine belonging to the CXC chemokine family. CXCL10 is secreted by several cell types in response to IFN-γ. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes/macrophages, T cells, NK cells, and dendritic cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. CXCL9, CXCL10 and CXCL11 have proven to be valid biomarkers for the development of heart failure and left ventricular dysfunction, suggesting an underlining pathophysiological relation between levels of these chemokines and the development of adverse cardiac remodeling.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68415478494

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Charles
Charlottesville, US
★★★★★ 5
Great product
Thankyou love the 522ink works great on my crafting
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
P
Verified Purchase
Peee
Omaha, US
★★★★★ 5
OMG!!! This Paper Is Amazing
Size: 1 Ream | 500 Sheets, Style: Letter (8.5x11)
Omg!!! This is seriously the best printer paper I’ve ever used. I honestly didn’t think paper could make that much of a difference until I tried this one. The quality feels so much better and thicker compared to regular cheap printer paper, and everything I print comes out super sharp and clean. Colors look brighter, text looks crisp, and the pages feel more premium. This paper is super clean bright white with a premium quality weight that immediately feels higher-end when you touch it. It makes documents, photos, and color prints look much more professional. I’ve used it for regular printing, important documents, and color prints, and my printer handles it perfectly without jams. It also doesn’t feel flimsy or thin when holding the paper. You can definitely tell this is higher quality paper right away. Now I don’t even want to go back to regular printer paper anymore lol. Definitely worth buying if you print a lot and want your documents to actually look nice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
K
Verified Purchase
Keicy Rafael Beltre Feliz
Massapequa, US
★★★★★ 5
Exceptional Quality for Professional Presentations
Size: 1 Ream | 500 Sheets, Style: Letter (8.5x11)
I recently purchased the Hammermill Premium Color 32 lb Copy Paper for a series of important presentations, and I am thoroughly impressed with its performance. This paper has elevated the quality of my work, making it stand out with its professional finish. Superior Brightness and Smoothness The 100 brightness rating ensures that colors pop and text is crisp, providing excellent contrast for both color and black-and-white prints. The ultra-smooth finish allows for superior toner adhesion, resulting in vibrant and sharp images without any smudging or bleeding. Heavyweight Durability At 32 lb, this paper offers a substantial feel, giving documents a premium weight that is noticeable. It holds up well during handling and conveys a sense of quality that lighter papers simply can't match. Reliable Performance I've used this paper in both laser and inkjet printers, and it has performed flawlessly in both. The 99.99% jam-free guarantee holds true; I have not experienced any jams or issues during printing, even with high-volume tasks. Eco-Friendly Choice Made in the USA and FSC certified, this paper is produced from responsibly managed forests, aligning with environmentally conscious practices. Conclusion For anyone seeking a high-quality paper that enhances the presentation of their work, the Hammermill Premium Color 32 lb Copy Paper is an excellent choice. Its brightness, smoothness, and durability make it ideal for presentations, proposals, and marketing materials. I highly recommend it for both professional and personal use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2025
A
Verified Purchase
Amazon Customer
Carnegie, US
★★★★★ 5
Great color for presentations
This paper feels very substantial and high-quality. It has a super bright finish that makes colors pop, and it never jams in my printer. Ideal for professional documents or presentations.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
C
Verified Purchase
Chronic Tsundoku
New York, US
★★★★★ 5
My go-to paper for my Junk Journaling printing
Size: 1 Ream | 500 Sheets, Style: Letter (8.5x11)
This is my go-to paper for printing out my junk journal printables. Unfortunately, my HP Smart Tank 7600r doesn't handle cardstark gracefully but this paper is a very good substitute. The ink pops nicely giving the amazing images a quality ground they deserve.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026

recommand products