SKU: 68631324497

LOX-1/OLR1 His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 9 - Sep 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LOX-1/OLR1 His Tag Protein, MouseProduct Specification Species Mouse Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR E1 Accession Q9EQ09 Amino Acid Sequence Arg60 Ile363, with N terminal 9*His

Product Specification


Species Mouse
Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR-E1
Accession Q9EQ09
Amino Acid Sequence

Arg60-Ile363, with N-terminal 9*His HHHHHHHHHRQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI

Expression System HEK293
Molecular Weight 45-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Sawamura, T. et al. (1997) Nature 386:73. 

2.Daugherty, A. et al. (2000) Curr. Opin. Cardiovasc. Pulm. Ren. Invest. Drugs. 2:223. 

3.Platt, N. and S. Gordon (2001) J. Clin. Invest. 108:649. 3

4.Platt, N. and S. Gordon (1998) Chem. Biol. 5:R193.

Background

Lectin-like oxidized low-density-lipoprotein receptor-1 (LOX-1), also known as oxidized low-density-lipoprotein receptor-1 (OLR-1), is a type II transmembrane receptor belonging to the C-type lectin family. It also belongs to the functionally defined scavenger receptor (SR) superfamily, whose members share the common ability to bind and internalize modified forms of Low Density Lipoproteins (LDL). LOX-1 is the first member of the class E scavenger receptor subfamily (SR-E). It binds and supports the internalization of multiple structurally unrelated macromolecules including oxidized LDL, advanced glycation end products (AGE), activated platelets, bacteria, apoptotic or aged cells, and heat shock proteins. LOX-1 has also been implicated as an intestinal receptor involved in the transcytosis of pancreatic bile salt-dependent lipase. The human LOX-1 gene encodes a 273 amino acid (aa) residue protein with a short N-terminal intracellular domain, a transmembrane domain, an extracellular stalk/neck region followed by a C-type lectin-like domain (CTLD). The CTLD, which is required for ligand recognition, contains the six conserved cysteine residues present in all C-type lectins, but lacks the Ca2+-binding residues found in classical C-type lectins. LOX-1 can be detected on activated endothelial cells, vascular smooth muscle cells, macrophages, intestinal cells and dendritic cells. The expression of LOX-1 is induced by proinflammatory or proatherogenic stimuli, as well as by oxidized LDL itself and hemodynamic or oxidative stress. Human LOX-1 exists on the cell surface as covalent homodimers, which can further associate into non-covalent-linked oligomers. Cell surface LOX-1 can also be cleaved by yet unidentified proteases to release the soluble LOX-1 extracellular domain. Binding and endocytosis of oxidized LDL by LOX-1 induces oxidative stress, activates NF kappa B, and upregulates the expression of monocyte chemoattractant protein-1 and matrix metalloproteases. LOX-1-dependent oxidized LDL uptake also induces apoptosis by inducing the expression of the pro-apoptotic Bax and downregulation of the anti-apoptotic Bcl-2. Oxidized LDL plays a key role in the pathogenesis of atherosclerosis and endothelial dysfunction. Blockade of LOX-1 functions may turn out to be a suitable target for the therapeutic intervention of atherosclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68631324497

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
C. Rohner
Boise, US
★★★★★ 5
As Close As You Will Get To Objectivity
Format: Paperback
If you have read "No Man Knows My History," you have to read "Rough Stone Rolling." The former biography was written by Fawn Brodie, a scholar who grew up LDS but left the church disenchanted and not believing that Joseph Smith was what he claimed to be--a prophet. The latter written by Bushman, a practicing LDS scholar who believes that Joseph Smith was a prophet. In the preface of "Rough Stone Rolling," Bushman makes the legitimate point that there will never be consensus on Joseph Smith's character or achievements. Furthermore, he confesses that as a believing historian, pure objectivity is impossible. Nonetheless, I think he comes closer to pure objectivity in this history than any other I have read on Joseph Smith. This has to be one of the best biographies I have ever read. The book is well written, loaded with historical fact, and any assumptions that are made are within detailed, historical contexts. Unlike Brodie's biography, it is very difficult to ascertain Bushman's own opinion. If he had not confessed his belief in the preface, you would wonder. Nowhere does Bushman try to convince you that Smith was a prophet and he is not afraid to explore Joseph Smith's weaknesses and shortcomings as a man. I am a believer so I admit that I may just relate to Bushman better than Brodie. Still, I know many practicing Mormons that would not like this book simply because they have to have Joseph Smith on a pedestal, untouchable, and locked in a glass case. I also know many faithful non-Mormons who believe that a prophet is certainly not a god but is definitely something more than human. Such readers will probably not care for this book either. I believe Joseph Smith was a prophet but I also know he was a man with weaknesses, like every other prophet that came before him. In Bushman's own words, "flawless characters are neither attractive or useful." This is a history of a man; it is not scripture. After boldly claiming heavenly visions, Joseph Smith penned a few great books of scripture that are well worth reading if you really want to explore the faith. Fawn Brodie takes the title for her biography from Joseph Smith's own admission in 1844 that "No Man Knows My History" and paints, in her opinion, the delusion and deceit behind Smith's confession. Bushman takes the title for his biography from Joseph Smith's own admission in 1843 that he is a "Rough Stone Rolling" and gives you the most real, honest, and fair assessment of his life that I have ever read. He gives you the man Joseph Smith, with his strengths and weaknesses, and leaves the opinions to the reader.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 15, 2013
J
Verified Purchase
J. A. White
Whiting, US
★★★★★ 3
Comprehensive, but not convincing to this non-believer
Format: Paperback
Having previously read Fawn Brodie's , I read this one to get the believer's view. Bushman is at his best describing the evolution of Smith's thinking and revelations. Although the book is long, it is well written and authoritative. It gives a deeper understanding of Smith's religious philosophy than does Brodie's book. To his credit, Bushman confronts many of the crucial controversies surrounding Smith. From my non-believer's perspective, however, the defenses of Smith are not remotely convincing. Some examples: 1. DNA analysis shows without question that the American Indians came from east Asia. This fact is in direct contradiction of the traditional LDS view that Native Americans are lost Israelites. Bushman argues that Smith may have been writing about a small tribe somewhere in New York, or about people outside North America altogether. Within a few pages, Bushman has forgotten about this controversy altogether, and happily describes the Book of Mormon as a history of the American Indians. 2. Smith made the huge mistake of reproducing parts of the hieroglyphics he claims to have interpreted as the "Book of Abraham." These documents have been translated by scholars and have nothing to do with Abraham. Bushman (pp. 291-2) puts forth the argument that Smith's translation may not have been a true translation, but instead may have been a divine revelation simply inspired by the presence of the scrolls. Bushman suggests the same for the Book of Mormon. This is a truly shocking stance for an LDS believer to take: if Smith's "translations" weren't translations, why should anyone believe that his revelations were divinely inspired? Ironically, Bushman's view here sounds much like Brodie's: Not anticipating that scholars would use the Rosetta stone to translate hieroglyphics, Smith imagined that bogus translations would not be found out. 3. Smith repeatedly lied about whether he and the Saints were practicing polygamy. Bushman's defense of Smith in this context reminds me of Bill Clinton's statements regarding Monica Lewinsky: Smith held a secret definition of the term "polygamy," and thus felt free to mislead (or lie) with impunity. The facts, as reported by both Brodie and Bushman, support the conclusion that Smith coerced women into his bed by arguing that their eternal salvation was at stake. The stain of Smith's lustful "revelation" regarding polygamy continues to haunt the LDS, which claims to recoil from earthly polygamy but argues that men (not women) get to have harems in heaven. Despite these complaints, I recommend this book to non-believers who are patient enough to get through it. I feel that I have much greater insight into the LDS mindset than I did before.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2008
I
Verified Purchase
Ian
Waukegan, US
★★★★★ 5
The definitive paperback edition
Format: Paperback
I purchased the Oxford World's Classics edition of "Le Morte d'Arthur: The Winchester Manuscript" for a school reading assignment, and I can say with confidence that this is the version you want. The original Old English is present (it was virtually a new language), complete with very useful footnotes to assist with antiquated words and phrases. The story was intriguing, colorful, and poignant (it's a downer, but a well-written one), filled with memorable characters such as Sir Gareth and Sir Launcelot. If you have a taste for classic literature and are looking for a challenge, definitely give "Le Morte d'Arthur" a read, especially with this version.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2023
J
Verified Purchase
Josephine DiNovo
Los Angeles, US
★★★★★ 5
This copy is an excellent modernization of Malory's text with helpful footnotes and endnotes
Format: Paperback
I got this book for class, so I've only read large segements of it. This copy is an excellent modernization of Malory's text with helpful footnotes and endnotes. The footnotes were always available to explain unfamiliar words without interrupting the flow of the story.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2016
N
Verified Purchase
Nico Agostinelli
Fort Morgan, US
★★★★★ 5
Fast Shipping
Format: Paperback
I received this book one week ahead of the expected shipping date. It was new and in good quality as described. Highly recommend this seller.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 9, 2024

recommand products