SKU: 71006314223

Mouse CD137, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 19 - Sep 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD137, His tagProduct Specification Species Mouse Synonyms 4 1BB ligand receptor, T cell antigen 4 1BB, Tnfrsf9, Ila, Ly63 Accession P20334 Amino Acid Sequence Protein sequence (P20334, Val24 Leu187, with C 10*His) VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 19. 2 kDa Observed

Product Specification


Species Mouse
Synonyms 4-1BB ligand receptor, T-cell antigen 4-1BB, Tnfrsf9, Ila, Ly63
Accession P20334
Amino Acid Sequence

Protein sequence (P20334, Val24-Leu187, with C-10*His) VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19.2 kDa Observed MW: 28, 32 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD137, a member of the tumor necrosis factor (TNF) receptor family, is a type 1 transmembrane protein, expressed on surfaces of leukocytes and non-immune cells.[1] Its alternative names are tumor necrosis factor receptor superfamily member 9 (TNFRSF9), 4-1BB, and induced by lymphocyte activation (ILA). It is of interest to immunologists as a co-stimulatory immune checkpoint molecule, and as a potential target in cancer immunotherapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71006314223

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Rebecca Jung
Draper, US
★★★★★ 3
Can’t keep for long period of time- develops a smell
Flavor Name: Wild Strawberry, Size: 0.15 Ounce (Pack of 1)
I’ve had this since December and was using daily, after a while it started to have a smell of old chapstick
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
T
Verified Purchase
T-Dawg
Boise, US
★★★★★ 5
Works well to prevent sunburn and stays on while working.
Size: 6 Ounce (Pack of 1), Style: Spray
This sunscreen is great! I've worked outside in New Mexico sun for the past few years and this is a life saver. Goes on evenly and doesn't come off while I'm working in the heat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
B
Verified Purchase
Bridhid Farrelly
Omaha, US
★★★★★ 5
Sunscreen 100 proof
Size: 6 Ounce (Pack of 1), Style: Spray
Works great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
M
Verified Purchase
MazeMama
Whiting, US
★★★★★ 5
Fabulous, especially for sensitive skin and those with aversion to textures.
Size: 6 Ounce (Pack of 1), Style: Spray
Keeps my skin from turning UGLIER. THIS actually WORKS. I do not wish to be any tanner than I come naturally, and this is the BEST sunscreen I've ever used. I do use a wipe to remove the overspray from my eye area. It does not irritate my incredibly sensitive skin, and sprays on easily..like a dream. No more sandy spf moments!..I can't stand that creamy+oily stuff all over my hands then throw in a little sand - now we have a sensory concern..NOT WITH THIS STUFF!! Highly recommend. Easy to use. KeyWest rays had nothing on this..we came back slightly tan, not burnt, and not a looking like a different ethicity. Reapply as recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 26, 2025
H
Verified Purchase
Hannah
San Leandro, US
★★★★★ 5
Best Sunscreen Ever
Size: 6 Ounce (Pack of 1), Style: Spray, Size: 6 Ounce (Pack of 1), Style: Spray
BEST. SUNSCREEN. EVER. Seriously. My skin is paper-white and I'm highly tattooed, so sun safety is very important to me. 100 SPF for total protection is unbeatable and I have yet to burn even a little. I'm also very texture-sensitive so I can't stand thick, gloopy, sticky lotions. This one actually sprays on clear, soaks in right away, is light, and even a little bit refreshing. The spray mechanism also makes it easier to get my back without help. There's no off-putting smell, no mess, no problems. I do reapply if I'm out for a while so I'll need to reorder soon, but I'm not mad about it at all. It's very affordable compared to the alternatives and entirely worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 7, 2023

recommand products