Pay in installments of $146.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 10 - Sep 15
For Your Every Summer RSVP, with Code: SUMMER15
Description
FCRL6/FcRH6 Fc Chimera Protein, HumanProduct Specification Species Human Antigen FCRL6 RCRH6 Synonyms FCRL6, FcRH6 Accession Q6DN72 Amino Acid Sequence Leu20 Trp307, with C terminal Human IgG1 Fc
Product Specification
| Species | Human |
| Antigen | FCRL6/RCRH6 |
| Synonyms | FCRL6, FcRH6 |
| Accession | Q6DN72 |
| Amino Acid Sequence | Leu20-Trp307, with C-terminal Human IgG1 Fc LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNWIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 72-80kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Da?ron M. et al. (2008) Immunoreceptor tyrosine-based inhibition motifs: a quest in the past and future. Immunol Rev. 224(1): 11-43. 2. Kulemzin S V. et al. (2011) FCRL6 receptor: expression and associated proteins.Immunol Lett. 134(2): 174-182. |
Background
Members of the Fc receptor-like (FCRL1-6) gene family encode transmembrane glycoproteins that are preferentially expressed by B cells and generally repress responses via cytoplasmic tyrosine-based regulation. The FCRL gene family contained six members with FCRL1, FCRL2, FCRL3, FCRL4, FCRL5 and FCRL6. FCRL6 is located at a separate chromosomal position from the FCRL1-5 locus, has conserved synteny in mammals and is situated between the SLAMF8 and DUSP23 genes. FCRL6 gene representatives are widely present in all mammalian families, including basal mammals such as elephants, pangolins, and armadillos. It is reported that the extracellular part of FCRL molecules contains multiples numbers of Ig-like domains and their cytoplasmictail contains immunoreceptor tyrosine -based activation motifs (ITAMs) and immunoreceptor tyrosine-based inhibitory motifs (ITIMs). In humans, FCRL6 encodes a type I surface glycoprotein with three Ig-like domains, a hydrophobic transmembrane segment, and a cytoplasmic tail with two tyrosines that constitute a consensus ITIM or a non-canonical ITAM. In vitro, FcRL6 does not greatly influence NK-cell or CD8(+) T-cell-mediated cytotoxicity and has minimal impact on cytokine secretion. FCRL6 ability to recruit SHP-1, SHP-2, SHIP-1, and SHIP-2 phosphatases, and also adaptor protein Grb2 through phosphorylated cytoplasmic tyrosines.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy