SKU: 72178424460

Human FSH alpha&FSH beta/CGA&FSHB protein, No tag&His tag

Sale price$139.50 Regular price$155.00
Save 10%

Pay in installments of $38.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 8 - Sep 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FSH alpha&FSH beta/CGA&FSHB protein, No tag&His tagProduct Specification Species Human Synonyms Follicle Stimulating Hormone, Follitropin, FSH Accession P01215P01225 Amino Acid Sequence Protein sequence1 (P01215, Ala25 Ser116) APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS; Protein sequence2 (P01225, Asn19 Glu129, with C His tag) NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE Expression

Product Specification


Species Human
Synonyms Follicle Stimulating Hormone, Follitropin, FSH
Accession P01215、P01225
Amino Acid Sequence

Protein sequence1 (P01215, Ala25-Ser116) APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS; 

Protein sequence2 (P01225, Asn19-Glu129, with C-His tag) NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Expression System HEK293
Molecular Weight

Predicted MW: 10.2 kDa(CGA)&14.2 kDa(FSHB);Observed MW: 20-25 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag (FSHB)&No tag (CGA)
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Follicle-stimulating hormone (FSH) is a gonadotropin, a glycoprotein polypeptide hormone. FSH is synthesized and secreted by the gonadotropic cells of the anterior pituitary gland and regulates the development, growth, pubertal maturation, and reproductive processes of the body. FSH and luteinizing hormone (LH) work together in the reproductive system. FSH is a 35.5 kDa glycoprotein heterodimer, consisting of two polypeptide units, alpha and beta. The alpha subunits of the glycoproteins LH, FSH, TSH, and hCG are identical and consist of 96 amino acids, while the beta subunits vary. Both subunits are required for biological activity. FSH has a beta subunit of 111 amino acids (FSH β), which confers its specific biologic action, and is responsible for interaction with the follicle-stimulating hormone receptor. The sugar portion of the hormone is covalently bonded to asparagine, and is composed of N-acetylgalactosamine, mannose, N-acetylglucosamine, galactose, and sialic acid.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72178424460

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Meighan
Birmingham, US
★★★★★ 4
Cute but not for a super chewer
Color: Green, Color: Green
It’s a super cute toy. My boy loves the squeaker toys and he’s a fast chewer. Unfortunately for him, he tore it up within 24 hours. It’s definitely not for super chewers but he had a good time with it while it lasted!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
A
Verified Purchase
AD
Louisville, US
★★★★★ 5
Decent toy
Color: Green
My dog loves this toy. He's already tore through the head but the middle part he has not been able to tare through. It's a great toy for a chewer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
M
Verified Purchase
Melanie Pendleton
Los Angeles, US
★★★★★ 5
Fun Toy That Keeps Dogs Entertained
Color: Green
WOWBALA Interactive Squeaky Dog Chew Toy was purchased for my two granddogs, and they both took to it right away. The squeaker and soft plush design keep them interested and engaged during playtime. It’s great for tug-of-war and seems to hold up well with regular use. I like that it works for different sizes so that both dogs can enjoy it together. I will be purchasing another one for my dog at home. Overall, it’s a fun and playful toy that keeps them busy and happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
B
Verified Purchase
Barbara Herges
Charlottesville, US
★★★★★ 3
Durability and lasting period of toy.
Color: Green
I got this toy for our bulldog. He had a hole in it, which will only progress, within minutes. I took it away until I could find out if there is any kind of warranty. The information says this toy is not for aggressive chewers, yet right in the description and the photo of the toy (that way I knew I was looking at the correct toy), it says for the "aggressive chewer". I am disappointed that even though it isn't how they described, it only lasted minutes before there was damage. Not sure if I would buy another product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2025
R
Verified Purchase
Roy Scarbrough
Cuba, US
★★★★★ 2
Won't last long
Color: Green
It lasted a couple weeks before my dog got it apart at the seams and had the stuffing all over the house. Won't hold up for long under aggressive play. I was going to return it, but my dog so loved this that I stuffed a sock in it and sewed it back together with heavier thread and more stitches. Hold up better for toys of the same price. Buy one, and have a sewing kit handy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026

recommand products