SKU: 72927981790

Mouse CD83, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 19 - Sep 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD83, his tagProduct Specification Species Mouse Accession O88324 Amino Acid Sequence Protein sequence (O88324, Met22 Arg133, with C 10*His) MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 14. 0 kDa Observed MW: 23 40 kDa Purity 95% by SDS PAGE Tag with C 10*His Physical Appearance Lyophilized Powder Storage Buffer Lyophilized

Product Specification


Species Mouse
Accession O88324
Amino Acid Sequence

Protein sequence (O88324, Met22-Arg133, with C-10*His) MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 14.0 kDa Observed MW: 23-40 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD83 (Cluster of Differentiation 83) is a protein encoded by the CD83 gene. The transmembrane domain of membrane-bound CD83 stabilizes MHC II, costimulatory molecules and CD28 in the membrane by antagonizing MARCH-family E3 ubiquitin ligases. It is not clear what ligands interact with CD83, but membrane-bound CD83 may homotypically interact with the soluble form, suggesting autocrine immune regulation. However, it contrasts with differences between the single expression of soluble CD83 on monocytes and membrane-bound CD83 on activated dendritic cells seems also as their good marker. Soluble CD83 also binds to CD154, leading to T helper type 2 lymphocyte apoptosis by suppression of Bcl-2 inhibitors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72927981790

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Beth
Battle Creek, US
★★★★★ 3
Not for side sleepers
Size: Standard (Pack of 2), Style: Medium, Configuration: Hometextile
These pillows are quite soft and flat, and offer very little support. I sleep on my side and can't use these pillows. I don't know why they're recommended for side sleepers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 31, 2025
S
Verified Purchase
Sharon Shelton
Lexington, US
★★★★★ 5
Good head and neck support
Size: Standard (Pack of 2), Style: Medium, Configuration: Hometextile
Soft yet firm, comfy, no toxic smell.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
S
Verified Purchase
Stephen Havranek
New York, US
★★★★★ 1
A pillow made of extras soft lumps and clumps. Defective.
Size: Standard (Pack of 2), Style: Medium, Configuration: Hometextile
This pillow should not even be sold. It's simple a super soft pillow with lumps of clumps of softness. Part of my head was even touching the mattress through the clumps. I ended up throwing it on the floor at 2 am and my head and neck hurt from it. I have never had a pillow of lumps before. I hope I can return this thing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
A
Verified Purchase
Alan M
Los Angeles, US
★★★★★ 5
Comfortable, Hypoallergenic, and Great Value
Size: King (Pack of 2), Style: Soft, Configuration: Pillow
These pillows are a solid upgrade for everyday sleep. They’re soft but still provide enough support for both back and stomach sleeping, and the down-alternative fill is perfect if you’re sensitive to allergens. The microfiber cover feels smooth and well-made, and they fluff up nicely after decompressing. Overall, a comfortable and affordable set that gets the job done.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
A
Verified Purchase
Amazon Customer
Boise, US
★★★★★ 5
Definitely worth buying
Size: King (Pack of 2), Style: Soft, Configuration: Pillow
These pillows are AWESOME! Soft, comfortable and fill up the pillowcases well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026

recommand products