Pay in installments of $135.62 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 12 - Sep 17
For Your Every Summer RSVP, with Code: SUMMER15
Description
Apo-SAA2 His Tag, HumanProduct Specification Species Human Synonyms Apo SAA2, SAA, SAA2, Serum Amyloid A2 Accession P0DJI9 Amino Acid Sequence MHHHHHHDDDDKRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY Expression System E. coli Molecular Weight 13. 2 kDa Purity 95% by SDS PAGE and RP HPLC Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 25mM Arg, 20mM Tris
Product Specification
| Species | Human |
| Synonyms | Apo-SAA2, SAA, SAA2, Serum Amyloid A2 |
| Accession | P0DJI9 |
| Amino Acid Sequence | MHHHHHHDDDDKRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY |
| Expression System | E.coli |
| Molecular Weight | 13.2 kDa |
| Purity | >95% by SDS-PAGE and RP-HPLC |
| Endotoxin | <2EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 25mM Arg, 20mM Tris-HCl, 150mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
SAA is similar to CRP and is used to evaluate the acute reaction process. SAA is a sensitive parameter. It begins to increase after about 8 hours of inflammatory reaction, and the time to exceed the upper limit of the reference range is earlier than that of CRP. However, the difference between the median value of CRP in normal people and the upper limit of the reference range is about 10 times. In SAA, it is only 5 times. For mild infections, for example, many viral infections, elevated SAA is more common than CRP. In infectious diseases, the absolute increase of SAA is higher than that of CRP, so the determination of SAA, especially for "normal" and minor acute reactions, should provide better differentiation. SAA is usually elevated in patients with a cold about 2pm 3, but CRP is also elevated in patients with less than 1pm 2. In viral infection cases, elevated concentrations of SAA and CRP were found in patients with adenovirus infection. The response patterns of SAA and CRP are parallel in the recovery phase of acute infection, which is suitable for both bacterial and viral infections. SAA was not elevated in lupus erythematosus and ulcerative colitis. The increase of SAA in the stage of malignant tumor metastasis is usually higher than that in the organ stage of the tumor. SAA detection is a very sensitive index for transplant rejection. In a study of kidney transplant recipients, 97% of the tests for rejection were based on elevated SAA. In the detection of irreversible transplant rejection, the average concentration was 690 ±29mg/L, while the correlation level in patients with reversible rejection was 271 ±31mg/L. A chronic increase in SAA concentration in patients with rheumatoid arthritis, tuberculosis or leprosy is a prerequisite for the synthesis of AA- starch fibers, which is also used to diagnose secondary amyloidosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy