SKU: 77673789900

Human IL-8 , His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-8 , His tagProduct Specification Species Human Synonyms C X C motif chemokine 8, Chemokine (C X C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1 (GCP 1), Monocyte derived neutrophil chemotactic factor (MDNCF), CXCL8 Accession P10145 Amino Acid Sequence Protein sequence(P10145, Ser28 Ser99, with C 10*His) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 10.

Product Specification


Species Human
Synonyms C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1 (GCP-1), Monocyte-derived neutrophil chemotactic factor (MDNCF), CXCL8
Accession P10145
Amino Acid Sequence

Protein sequence(P10145, Ser28-Ser99, with C-10*His) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight

Theoretical:10.1kDa Actual:10kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 8 (IL-8 or chemokine (C-X-C motif) ligand 8, CXCL8) is a chemokine produced by macrophages and other cell types such as epithelial cells, airway smooth muscle cells and endothelial cells. Endothelial cells store IL-8 in their storage vesicles, the Weibel-Palade bodies. IL-8 is initially produced as a precursor peptide of 99 amino acids which then undergoes cleavage to create several active IL-8 isoforms. In culture, a 72 amino acid peptide is the major form secreted by macrophages. Interleukin-8 is a key mediator associated with inflammation where it plays a key role in neutrophil recruitment and neutrophil degranulation. IL-8 has also been implied to have a role in colorectal cancer by acting as an autocrine growth factor for colon carcinoma cell lines or the promotion of division and possible migration by cleaving metalloproteinase molecules. It has also been shown that IL-8 plays an important role in chemoresistance of malignant pleural mesothelioma by inducing expression of transmembrane transporters.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 77673789900

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
CEAM
Natrona Heights, US
★★★★★ 4
Tastes Great, But More General Wellness Than Targeted Feminine Support
I tend to prefer gummies over capsules whenever possible, so these Yalei 4-in-1 Nuora Feminine Balance Gummies caught my attention as a potential replacement for my usual women’s probiotic. The bottle contains 60 gummies (30 servings), with a formula centered around vitamin C, pineapple fruit powder, and Bacillus coagulans (1 billion CFU). The ingredient list is clean and clearly labeled, and I appreciated that it’s free from common allergens like soy, dairy, gluten, and tree nuts. The outer and inner tamper seals were intact. The manufacturing and expiration dates were also easy to read, which is something I always look for with supplements. Taste-wise, these are genuinely enjoyable. The pineapple flavor is pleasant, not overly artificial, and there’s no lingering aftertaste. The texture is firm without being sticky, which makes them easy to take daily. Honestly, these fall into that category where it’s tempting to eat more than the serving size. Where things became more nuanced for me was performance. I switched from a more targeted women’s probiotic that included specific Lactobacillus strains and additional D-mannose and cranberry support ingredients. Within about two weeks of making the swap, I experienced a UTI flare-up, which led me to go back to my previous formula. That experience made the difference in formulation stand out. My prior supplement included strains commonly associated with vaginal microbiome support along with additional complementary ingredients, whereas this product uses a single Bacillus-based probiotic strain. From my experience, this felt more like a general wellness probiotic gummy rather than something formulated for more targeted feminine health concerns. That doesn’t make it a bad product–it just depends on what you’re looking for. If your goal is a simple, good-tasting daily probiotic with light supportive ingredients, this fits that role well. If you’re specifically trying to maintain balance in more sensitive or recurring situations, you may want something more specialized. The brand also includes details like GMP manufacturing claims and batch testing which adds a layer of reassurance, though it does appear to be a newer brand. At its current lower price point, I do think it offers decent value for a general-use gummy. For me personally, though, I’ll be sticking with a more targeted formula moving forward.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
B
Brian J.
Louisville, US
★★★★★ 5
Probiotic fruit snacks
Disclaimer: vine review of an item I requested free* These taste great, just like fruit snacks. I've gotten a lot of gummies from this brand and haven't found a bad one yet. Pineapple isn't even a flavor I usually like, but these taste good. Somehow they're always sweet with no weird aftertaste without having added sugar. Not too sticky, it doesn't leave residue on your fingers, but they do sometimes stick together. Mainly I got these to have some fruit snacks to eat, but the probiotics are a nice bonus and now I can pretend I'm being healthy when I eat my candy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
K
Verified Purchase
kenzie
Boise, US
★★★★★ 5
Great matcha for a great price per oz!
Size: 16 Ounce (Pack of 1), Size: 16 Ounce (Pack of 1)
This is my second bag of this matcha. The value for the quantity and quality is unbeatable. I will continue to buy and use this every single day because I’m so happy with it. I use one scoop (they provide the scooper) and blend into a little warm water with some vanilla and maple syrup. Then add warm milk. Or pour milk over ice and matcha over top. Delicious! Just the right amount of energy with no crash.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
H
Verified Purchase
Hollie’s Honest Finds
Battle Creek, US
★★★★★ 5
Smooth, vibrant, and perfectly authentic matcha!
Size: 16 Ounce (Pack of 1)
This is my favorite matcha by far! It has that rich, deep green color and fresh aroma that tells you right away it’s high quality. The flavor is smooth, earthy, and authentic — exactly the taste I’ve always loved in traditional matcha. The bag is generous in size for the price, and my most recent order even came with a little scoop on top, which was such a thoughtful touch! I like to mix mine with milk and honey for a creamy, delicious latte, and it dissolves beautifully in hot water without clumping. I usually make about 12 ounces at a time using the scoop provided and drink it two or three times a day. It gives me calm, focused energy without any jitters — the perfect coffee alternative, especially now that I’m pregnant. Pure, unsweetened, and organic — it’s everything matcha should be. Highly recommend this brand! 🍵💚
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 12, 2025
M
Verified Purchase
Meric Kuhn
Carnegie, US
★★★★★ 5
This is a better quality matcha than what is used at Starbucks!
Size: 32 Ounce (Pack of 1)
This product is better than the matcha powder mix used at Starbucks! Starbucks uses a 51% sugar mix with questionably sourced matcha/sencha making up the other 49%. It has no tea flavor as it's basically just sweetened milk. If you've come to matcha through the Starbucks lens, this is NOT that product. It's what you should be drinking instead! When I've tried to get matcha powder locally at the grocery store, I've not been able to find one that is the same quality as this in such a value size quantity. For size reference, I'm pretty sure this size bag could last one person 3mos even if they were drinking a matcha latte everyday. This matcha here packs a bolder flavor, a better boost of energy, and more mental clarity without the crash that you'd have from coffee. It is unsweetened, which gives you the freedom to make the final product (latte, smoothie, whatever) as sweet or unsweet as you like. The powder is ULTRA fine, and is about the consistency of powdered sugar. It dissolves wonderfully in a few ounces of the liquid of your choice (I prefer oatmilk), and it suspends very nicely and does not sink to the bottom when at rest for a few moments. All around highly recommend. Unless you're Japanese and have had that real good stuff and would know the difference, this is probably good enough for most people.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2024

recommand products