SKU: 79367849

S100B Protein, Human

Sale price$178.20 Regular price$198.00
Save 10%

Pay in installments of $49.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 13 - Sep 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

S100B Protein, HumanProduct Specification Species Human Accession P04271 Amino Acid Sequence Ser2 Glu92, with N terminal 8*His MHHHHHHHHSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE Expression System E. coli Molecular Weight 11 12 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <2EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution Reconstitute at less than 1

Product Specification


Species Human
Accession P04271
Amino Acid Sequence

Ser2-Glu92, with N-terminal 8*His MHHHHHHHHSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Expression System E.coli
Molecular Weight

11-12 kDa(Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

S100B is a small calcium-binding protein in the neuronal system, and belongs to the S100 family. S100B proteins are a family of 25 homologous intracellular calcium-binding proteins characterized by EF hand motifs, low molecular weights (9–13 kDa), ability to form homodimers, heterodimers and oligomeric assemblies, and are characterized by tissue and cell-specific expression.  They are solely present in vertebrates. S100B protein is mainly expressed in the neuronal system such as astrocytes, maturing oligodendrocytes, dendritic cells, and Schwann cells. However, some other cells outside the brain, like kidney epithelial cells, ependymocytes, chondrocytes, adipocytes, and melanocytes, can also express S100B protein.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 79367849

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jeffer
West Palm Beach, US
★★★★★ 3
My 13lb dog loves these! But tears them up in no time!
Size: 15", Style: Rabbit
I’ve bought many of these, in different styles. My dog knows it as “bunny”, so if you tell him to “go get bunny”, this toy (or one of the other characters we’ve bought) comes back in his mouth. He loves to chase it, play tuggy, and whip his head back and forth with the poor thing. He turns these into threads hanging on to rope in no time. You’d think they would be super durable, but they don’t surprise him very long. I can’t rate higher than a 3 star, because I think they are made well but he’s just really tough on them and I keep buying one version or another because he loves bunny. LOL
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 23, 2024
E
Verified Purchase
ehh
Houston, US
★★★★★ 5
Durable & fun
Size: 15", Style: Rabbit
These are great pulls, long lasting. The rope in different parts make it interesting to your pet. My only issue is, I did not receive the gray animal I ordered. It was substituted by a brown one. I’ve owned six of these. The dogs have loved them all BUT neither of them will touch this brown one. I’ve tried several games with it. They run, take a sniff, & leave it. This one was a wasted $10.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2022
F
Verified Purchase
FussKM
Houston, US
★★★★★ 5
Toughest toys around!!!
Color: Gorilla, Size: Small
After 30 years of shopping for dog toys & endless nights of sewing them back together, those days are over thanks to this brand of toys! These get taken outside where they are brutally tugged, twisted, snatched, tossed and shaken to no end by our 58lb black mouth cur & 80lb Shepherd Retriever mix. Most times they bring them back in the house but 2 of them they keep outside in the scorching Florida sun & rain & they're still tough as can be! The only damage these 2 toy punishers have managed to do is occasionally kill a squeaky inside (after about a year or more) & eventually the ones they will keep outside they have managed to get the black trim piece that goes around the outside edge to come off in a small section but it's still hanging on the toy flapping around smacking them in the face (which our black mouth cur love's,lol). I first bought 2 small ones (yellow duck & pink pig) Christmas 2020. They held up so well that a few months later I bought the fox, dog & purple gecko. We also have the gorilla, snake, green gator (their favorite right now), orange gecko, a 2nd duck, raccoon & a few others I can't think of right now. The glorious thing is I haven't had to sew a single toy in over 2 years & I don't have to worry about my girls getting too rough with them when playing & the best part is not having to worry about them defluffing them & ingesting it or choking on it especially when I'm not at home. I don't have to pick them up before leaving to ensure they are safe. They can continue to terrorize the house playing with these even when we're not there & the only thing I have to worry about is what are they going to break when they sling one of these across the room. This brand is the only brand of dog toy we buy now. We have not had to throw any of them that we've bought away either & the cost is perfect for the value that you definitely get!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2022
H
Verified Purchase
Heather Svoboda
Fort Morgan, US
★★★★★ 5
The only toy my dog wants
Color: Gator, Size: Large, Color: Gator, Size: Large
I have a 9 year old, 12 pound chihuahua, and this toy is everything to him. Ever since he was a tiny puppy, he’s liked toys that are at least as big as he is. Once I got him this, it was the only toy he’d play with. He carries it everywhere. He likes to chew on it, and sometimes pulls apart the threads. He LOVES to play tug of war with it, so the handle is awesome. It has so many squeakers, which is also a plus, and it holds up well for our little guy. We’ve probably had at least 10 of this same toy, we get him a new one about once a year when it starts to get worn. I worry that if they ever stop making it, he’ll be depressed lol. It’s been with him at all life stages and he doesn’t go anywhere without it. Really can’t ask for more when your dog loves a toy this much
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 1, 2025
M
Verified Purchase
MM
Dallas, US
★★★★★ 5
Lots of squeakers in this one!
Color: Gator, Size: Large
Our rescue dog is a power chewer so this one doesn't last long, but I still gave 5 stars because it's not advertised for power chewers, so I knew what we were getting when we bought it. So why did I buy this for our dog? The number of squeakers... the dog goes nuts for those and it makes the toy last longer because she will only play with the ones that still squeak.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 18, 2024

recommand products