SKU: 79684843909

Human TNF-β Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TNF-β Protein, His TagProduct Specification Species Human Synonyms Lymphotoxin alpha, LT alpha, TNF beta, Tumor necrosis factor ligand superfamily member 1, LTA, TNFB, TNFSF1 Accession P01374 Amino Acid Sequence Protein sequence (P01374, Leu35 Leu205, with C His Tag) LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL Expression System HEK293 Molecular

Product Specification


Species Human
Synonyms Lymphotoxin-alpha, LT-alpha, TNF-beta, Tumor necrosis factor ligand superfamily member 1, LTA, TNFB, TNFSF1
Accession P01374
Amino Acid Sequence

Protein sequence (P01374, Leu35-Leu205, with C-His Tag) LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Expression System HEK293
Molecular Weight Predicted MW: 20.3 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNF-beta, also known as Lymphotoxin-alpha (LTα), is a cytokine belonging to the tumor necrosis factor (TNF) superfamily. Its primary function involves the development and organization of secondary lymphoid organs, such as lymph nodes and spleen, during embryogenesis. In adulthood, TNF-beta is a key mediator in the maintenance of the lymphoid architecture and the initiation of inflammatory responses against pathogens. It exists in two forms: a soluble homotrimer that signals through TNF receptors 1 and 2, and a membrane-bound heterotrimer with LTβ, which signals through the LTβ receptor. Dysregulation of TNF-beta is implicated in autoimmune and chronic inflammatory diseases, making it a significant therapeutic target.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 79684843909

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
rcevans
Lexington, US
★★★★★ 5
Engine air filters are important!
Size: 8.26" x 5.63" x 2.24"
Just like me and you breathing, your car performs better when it can breathe freely and cleanly. My philosophy with an engine air filter is to replace with cheap and often. You can't control the quality of air coming into your system but you can control the filtering, so I'd rather replace the filter on an accelerated schedule with a cheap product than to invest into something more expensive and have it perform dirty for longer than it should. For my Honda CRV 2024 Hybrid, this filter fits snuggly and performs well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2025
J
Verified Purchase
Jeff
Chelsea, US
★★★★★ 5
honda civic
Size: 17220-5AA-A00
Great item and price, well packed. Arrived as scheduled. They fit my Honda Civic Xle
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
D
Verified Purchase
Digigeek
Battle Creek, US
★★★★★ 5
Good non OEM replacement filter
Size: 165465NA1C
I recently purchased the Forccord 2-Pack Engine Air Filter for my INFINITI QX50 (2025/2024-2019) and QX55 (2025/2024-2022), and overall, it’s a decent alternative to the OEM filter. Pros: Perfect Fit – Installed easily in my QX50 without any issues. Fits just like the factory filter. Good Filtration – The material seems effective in trapping dust and debris, helping keep the engine clean. Affordable 2-Pack – Great value compared to dealership prices, especially if you replace filters regularly. Improves Airflow – Noticed a slight improvement in engine responsiveness and fuel efficiency. Cons: Not OEM Quality – The filter material feels a bit thinner and less sturdy compared to the original Infiniti filter. May Not Last as Long – While it works fine now, I’m unsure if it will hold up for the same mileage as an OEM filter. No Installation Instructions – Though easy to install, a simple guide would have been helpful for first-time users. Final Thoughts This Forccord air filter is a good budget-friendly replacement that fits well and performs decently. However, if you prioritize OEM durability and quality, you may want to stick with the original Infiniti filter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2025
A
Verified Purchase
Amazon Customer
Natrona Heights, US
★★★★★ 5
Keeps your engine running
Size: 17220-5AA-A00
Fits well, fair price, does the job as promised
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
A
Verified Purchase
Amazon Customer
Draper, US
★★★★★ 5
Good
Size: 17220-5AA-A00
Good filter and low price
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products