Pay in installments of $29.38 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 1 - Sep 6
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human PAR1 Protein, His tagProduct Specification Species Human Synonyms Proteinase activated receptor 1, PAR 1, Coagulation factor II receptor, Thrombin receptor, F2R, CF2R, PAR1, TR Accession P25116 Amino Acid Sequence Protein sequence (P25116, Ser42 Thr102, with C His tag) SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT Expression System HEK293 Molecular Weight Predicted MW: 8. 8 kDa Observed MW: 15 26 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation
Product Specification
| Species | Human |
| Synonyms | Proteinase-activated receptor 1, PAR-1, Coagulation factor II receptor, Thrombin receptor, F2R, CF2R, PAR1, TR |
| Accession | P25116 |
| Amino Acid Sequence | Protein sequence (P25116, Ser42-Thr102, with C-His tag) SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 8.8 kDa Observed MW: 15-26 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | with C-His tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Protease-activated receptor 1 (PAR1), also known as thrombin receptor, is a member of the G-protein-coupled receptor (GPCR) family and a critical mediator of cellular responses to proteolytic enzymes, particularly thrombin. Activated by proteolytic cleavage at its N-terminal domain, PAR1 initiates signaling cascades via G proteins (e.g., Gαq/11, Gα12/13), regulating processes like platelet aggregation, vascular smooth muscle contraction, inflammation, and wound healing. Dysregulated PAR1 signaling is implicated in thrombosis, atherosclerosis, cancer cell migration, and fibrotic diseases.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy