SKU: 80812290973

USP11 Protein

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

USP11 ProteinProduct Specification Species Human Antigen USP11 Synonyms HX1,Deubiquitinating enzyme 11, Ubiquitin carboxyl terminal hydrolase 11,Ubiquitin specific peptidase 11,Ubiquitin specific protease 11 Accession P51784 Amino Acid Sequence Asp67 Glu300, with N terminal 8*His

Product Specification


Species Human
Antigen USP11
Synonyms HX1,Deubiquitinating enzyme 11, Ubiquitin carboxyl-terminal hydrolase 11,Ubiquitin specific peptidase 11,Ubiquitin specific protease 11
Accession P51784
Amino Acid Sequence

Asp67-Glu300, with N-terminal 8*His HHHHHHHHDREPQHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE

Expression System E.coli
Molecular Weight

28kDa (Reducing)

Purity >95% by SDS-PAGE&HPLC
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1. Haruko Ideguchi, et al. (2002) C Structural and functional characterization of the USP11 deubiquitinating enzyme, which interacts with the RanGTP-associated protein RanBPM. Biochem J. 1;367(Pt 1):87-95.
2. Key-Hwan Lim, et al. (2016) Ubiquitin-specific protease 11 functions as a tumor suppressor by modulating Mgl-1 protein to regulate cancer cell growth. Oncotarget. 22;7(12):14441-57.

Background

USP11 is also named as UHX1 and belongs to the peptidase C19 family. It is a deubiquitinating enzyme that controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. USP11 as a novel regulator of Mgl-1 and it requires RanBPM to regulate proteasomal degradation of Mgl-1. USP11 showed deubiquitinating activity and stabilized Mgl-1 protein. However, USP11-mediated Mgl-1 stabilization was inhibited in RanBPM-knockdown cells. Furthermore, in the cancer cell migration, the regulation of Mgl-1 by USP11 required RanBPM expression. In addition, an in vivo study revealed that depletion of USP11 leads to tumor formation. Taken together, the results indicated that USP11 functions as a tumor suppressor through the regulation of Mgl-1 protein degradation via RanBPM. USP11 may be a ubiquitous protein in various human tissues. By immunofluorescence assay, USP11 primarily was localized in the nucleus of non-dividing cells, suggesting an association between USP11 and RanBPM in the nucleus. Furthermore, the association between USP11 and RanBPM in vivo was confirmed not only by yeast two-hybrid assay but also by co-immunoprecipitation assays using exogenously expressed USP11 and RanBPM.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 80812290973

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LucasCoto
Louisville, US
★★★★★ 4
Run small, size it up
Color: Mushroom, Size: 32W x 30L, Color: Mushroom, Size: 32W x 30L
They go small, Im 5'8", 165lbs, usually 32x30 fits just rigth in most brands Levis, Izod, whatever, can't even close the zipper on this one, my dingus prints in the front if I manage to close it, I will try a 34 or even 36, if you want one, size it up. Length is right. Anyway, the pant is good, sturdy looking material, is not soft but nothing uncomfortable probably gets right after break it in, reinforced stitches on pockets. I think they would work great for a technician, salesman or an engineer, those jobs where you have to look like a human being with a polo shirt but sometimes needs to do something without ripping your pants while crouching or for daily abuse of the regular Joe, will try another that fits
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
R
Verified Purchase
Red
West Palm Beach, US
★★★★★ 5
Best Value For The Money
Color: Black, Size: 36W x 32L
My grandson uses these for work. Well-made and durable. Worth the price. Fit is comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
R
Verified Purchase
Ranae Ledford
Louisville, US
★★★★★ 5
Good, but size up!
Color: Black, Size: 30W x 29L
These are exactly what I wanted, but as many have stated, you need to size up. I found that going up two sizes (from my usual 28 to a 30) made for a great fit. I love that they come in a 29 length. One anything point is they came with creases in them from being folded in the package for a length of time. I had to steam and press them before wearing. I’ll likely buy them in other colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
W
Verified Purchase
William B. Fisher
Houston, US
★★★★★ 5
Great Pants
Color: Khaki, Size: 46W x 32L
Great pants but buy one size up in the waist. They are well made, comfortable, and good looking. They are Dickies brand what more needs to be said.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
H
Verified Purchase
H
Phoenix, US
★★★★★ 4
order 3 or 4 inches up than your usual waist, run very small in waist
Color: Charcoal, Size: 33W x 30L
arrived with dirt on the bottom legs but amazon helped with that. anyway I weigh 115 lbs and am 5'8 and I am a woman. I know that Dickies these days run super small for their size, so it sounds insane but order up 4 inches than your normal waist size, then run small in the waist and they will shrink a size with a few washings. I ordered a 33 waist and they did shrink probably a size in one wash lol! they are still a bit loose in the waist but not big and I know with a couple more washings they will be just right. I do not like anything skinny fit or with no give. but yah, I love the charcoal gray color, one of my favorite colors, much cooler than plain black. I normally enjoy the Dickies shorts but with these forty something degree afternoons these are my new go tos. I am not a jeans person and I sure as hell with not be wearing pajama pants out in public like these dang younger adults lately.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2025

recommand products