SKU: 8240806257

Mouse CD105, His tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD105, His tagProduct Specification Species Mouse Synonyms Cell surface MJ7 18 antigen, Edg Accession Q63961 Amino Acid Sequence Protein sequence (Q63961, Glu27 Gly581, with C 10*His)

Product Specification


Species Mouse
Synonyms Cell surface MJ7/18 antigen, Edg
Accession Q63961
Amino Acid Sequence

Protein sequence (Q63961, Glu27-Gly581, with C-10*His) ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 61.7 kDa Observed MW: 75 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Endoglin (ENG) is a type I membrane glycoprotein located on cell surfaces and is part of the TGF beta receptor complex. It is also commonly referred to as CD105, END, FLJ41744, HHT1, ORW and ORW1. It has a crucial role in angiogenesis, therefore, making it an important protein for tumor growth, survival and metastasis of cancer cells to other locations in the body. It is involved in modulating a response to the binding of TGF-beta1, TGF-beta3, activin-A, BMP-2, BMP-7 and BMP-9. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8240806257

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Birmingham, US
★★★★★ 5
Perfect for Toddlers
Size: 8 Toddler, Color: Navy
These are great for toddlers! Keeps my grandson’s toes safe yet cooler than sneakers for the summer. He loves them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
S
Verified Purchase
Sashunia
Belleville, US
★★★★★ 5
Great looking shoe!
Size: 11 Little Kid, Color: Tan, Size: 11 Little Kid, Color: Tan
We got these sandals specifically for our Caribbean vacation over thanksgiving break. They run true to size but I did get them one size bigger to hopefully last for next summer as well. They look great on and go with everything! My son said they feel very comfortable on his feet and he likes easy on/off due to Velcro closure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2025
A
Verified Purchase
Amy Kim
Port Orchard, US
★★★★★ 5
The Perfect Sandal for Active Kids!
Size: 8 Toddler, Color: Navy
I recently purchased the Stride Rite 360 Boy's Paddy Sandal for my son, and I couldn't be happier with my decision! From the moment he slipped his feet into these sandals, I could tell we were both going to be very pleased. Comfort & Fit: 5/5 - The Paddy Sandal has surpassed all expectations in terms of comfort and fit. The adjustable straps make it incredibly easy to get a snug, perfect fit for my son's feet, ensuring the sandals stay securely on, no matter how much running and jumping he does. The soles are cushioned just right, offering support without sacrificing flexibility, which is essential for a growing child. Durability: 5/5 - Stride Rite has always been synonymous with quality, and these sandals are no exception. They've endured days at the park, sandy beaches, and endless pavement adventures, yet they show minimal wear and tear. The materials are top-notch, promising many more months of active use. Ease of Use: 5/5 - For busy parents, the ease with which these sandals can be put on and taken off is a huge relief. The hook and loop closure is strong and stays in place, but it's simple enough for my son to handle on his own, fostering his independence. Overall Experience: 5/5 - It's rare to find a shoe that ticks all the boxes for both parent and child, but the Stride Rite 360 Boy's Paddy Sandal does just that. They've been a fantastic investment in my son's summer wardrobe and overall comfort during his daily activities. I would highly recommend these sandals to any parent looking for a reliable, comfortable, and stylish option for their child. Stride Rite has outdone themselves once again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2024
S
Verified Purchase
Spensanna Mayberry
Bozeman, US
★★★★★ 5
Great
Size: 8 Toddler, Color: Navy
Just as pictured and the padding is super comfortable, our 3 year old is rough on shoes but we love stride rite the quality it good and easy to clean perfect for wide toe area
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
T
Verified Purchase
Tori
Lowell, US
★★★★★ 5
Great toddler shoes!
Size: 6 Toddler, Color: Navy
Cute, comfy, practical and perfect for my toddler son
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 9, 2025

recommand products