SKU: 82734847609

Human Cathepsin B, His tag

Sale price$139.50 Regular price$155.00
Save 10%

Pay in installments of $38.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Cathepsin B, His tagProduct Specification Species Human Synonyms APP secretase (APPS), Cathepsin B1, CPSB Accession P07858 Amino Acid Sequence Protein sequence (P07858, Met1 Ile339, with C 10*His)

Product Specification


Species Human
Synonyms APP secretase (APPS), Cathepsin B1, CPSB
Accession P07858
Amino Acid Sequence

Protein sequence (P07858, Met1-Ile339, with C-10*His) MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 39.5 kDa Observed MW: 43 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Cathepsin B belongs to a family of lysosomal cysteine proteases known as the cysteine cathepsins and plays an important role in intracellular proteolysis. In humans, cathepsin B is encoded by the CTSB gene. Cathepsin B is upregulated in certain cancers, in pre-malignant lesions, and in various other pathological conditions. Cathepsin B may enhance the activity of other proteases, including matrix metalloproteinase, urokinase (serine protease urokinase plasminogen activator), and cathepsin D, and thus it has an essential position for the proteolysis of extracellular matrix components, intercellular communication disruption, and reduced protease inhibitor expression. Cells may become carcinogenic when cathepsin B is unregulated. Cathepsin B has been proposed as a potentially effective biomarker for a variety of cancers. Overexpression of cathepsin B is correlated with invasive and metastatic cancers.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 82734847609

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
V
Verified Purchase
Vetswife1
Birmingham, US
★★★★★ 5
Lil more pep!
I can tell a difference in my energy level with this product. No problem with sleep quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 20, 2025
D
Verified Purchase
Dannine Pritchard
Carnegie, US
★★★★★ 4
They work!
They work!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 17, 2025
K
Verified Purchase
Karen
Pawtucket, US
★★★★★ 5
Perfect Quality.
Format: Hardcover, Format: Hardcover
Cloth bound cover with printed foil design on the front cover. The lettering color ; as well as the picture illustrations, are entirely printed in blue ink. There is a removable price sticker on the back of the book, which it is hard to remove without it leaving glue residue behind, therefore I myself left it as it was. The sprayed edges are also of blue metallic color. Very nice quality book I recommend buying it. My copy of the book had only a very tiny indentation on the edge of the top front cover but hardly anything to make a fuss about.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2026
A
Verified Purchase
August Merryweather
Belleville, US
★★★★★ 5
Wonderful book
Format: Hardcover
I have given this book as a gift to so many people at times that their lives are taking a turn.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
N
Verified Purchase
noeau
Lexington, US
★★★★★ 5
Beautiful physical book / perception altering offerings
Format: Hardcover
I encountered this book when I was 9 years old and it completely changed the way I lived my life and viewed others. No more woe is me, nor life isnʻt fair. Instead I realized my actions and perceptions are in my control. Truly mind altering. Annually I have a selection of books and other writings, including The Prophet, that I read again. The Prophet is always fresh and I come away with new eyes and attitude. The hardcover book is beautiful with the book pages kissed with a serene blue that is reflected on the cover and the text within. Just looking at the book makes me feel calm and ready for the words of love, acceptance, and the freedom to be. I purchased this book for myself to replace the tattered paperback I was given as a child. After reading and rereading over the past couple of days I am going to purchase a few more books to gift to people I love.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2024

recommand products