SKU: 83907733767

Human Thrombopoietin, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Thrombopoietin, His tagProduct Specification Species Human Synonyms C mpl ligand (ML), Megakaryocyte colony stimulating factor, Megakaryocyte growth and development factor (MGDF), Myeloproliferative leukemia virus oncogene ligand, THPO, MGDF Accession P40225 Amino Acid Sequence Protein sequence(P40225, Ser22 Gly353, with C 10*His)

Product Specification


Species Human
Synonyms C-mpl ligand (ML), Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor (MGDF), Myeloproliferative leukemia virus oncogene ligand, THPO, MGDF
Accession P40225
Amino Acid Sequence

Protein sequence(P40225, Ser22-Gly353, with C-10*His) SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical:37.1kDa Actual:75-90kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months,

-20 to -70 °C under sterile conditions after reconstitution.

1 week, 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.

Background

Thrombopoietin (THPO) also known as megakaryocyte growth and development factor (MGDF) is a protein that in humans is encoded by the THPO gene. Thrombopoietin is a glycoprotein hormone produced by the liver and kidney which regulates the production of platelets. It stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Megakaryocytopoiesis is the cellular development process that leads to platelet production. Thrombopoietin is a humoral growth factor necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 83907733767

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nicolas
Draper, US
★★★★★ 4
Great scent, but leaves a film on my skin.
I was expecting bars of soap with more of a peppermint/eucalyptus fragrance and I just could not relate those fragrances to what the soap actually smells like. The Viking Revolution soap doesn't smell bad per se, and actually for me is rather fragrance neutral like you might find with the more sterile hospital and clinic type soaps. The lather factor for the Viking Revolution soap is mild to moderate in our hard water. It doesn't overdo lathering up but does lather up enough to let you know it is soap and is rather pleasing when rinsing it off where with some soaps you rinse and rinse and still need to rinse more to get the lather off your skin. I wash my hands and face many times throughout the day and night and so far the Viking Revolution soap has done a great job in leaving me feel a bit more refreshed and clean. I have noticed a bit of moisturizing of my face and hands being much softer after use, so the Viking Revolution soap does seem to come through with that feature. I handle and am around livestock and animals quite often and did notice that the soap seemed to cut through the grime pretty easily. I haven't tried the Viking Revolution as a body wash type soap. The square bars are just about a perfect fit for my hand and are easy to hold onto. I will use one bar for the shower and keep the bar in a drip rack where it has a chance to dry out after use. I do really like the presentation of the soap itself and it's a nice touch that each bar comes individually wrapped and includes a sticker and a small card. A rather attractive package if you are giving it for a gift. I'm more favorable of recommending this soap than not recommending it. The only reason I am giving 4 stars is for the fragrances not really being detectable as peppermint and eucalyptus.I do think I would buy this soap again though, fragrance or not.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2024
K
Verified Purchase
Khamisilah Muhammad
Port Orchard, US
★★★★★ 5
Awesome soap!
I love this soap. It was a little small, ut was great quality. If smelled good and did not break me out. I have very sensitive skin and this was very gentle on my skin. I usually use caswell and Massey soap and this soap is every bit as good as my normal c&m soap. Very good soap. I Will definitely will buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2024
I
Verified Purchase
ilmod
Whiting, US
★★★★★ 3
Scent is too perfumey
This soap pack is ok for the price, but the bars don't lather very well. They do have a good level of moisturizer that doesn't feel too oily, but my big complaint is the scents. The black one is ok, but the others are like cheap perfume. And I mean CHEAP perfume. It actually hurts my nose. I have used higher end soaps with a beautiful scent that is subtle and natural. This is not that. Overall not a bad product for the price, but don't expect to smell like a $1 perfume. Yuck
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2024
J
Verified Purchase
jeff
Draper, US
★★★★★ 5
Great scents and clean feel.”
This 4-pack (Sandalwood Amber, Mint Olive, Turmeric Citrus, Activated Charcoal) hits the mark. Natural, handmade, and leaves skin feeling fresh without drying out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 20, 2025
N
Verified Purchase
N. Narvais
Natrona Heights, US
★★★★★ 5
Items works just as described.
great soap. Lots of suds, no lingering perfumy smell, and seems to last longer than most.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 6, 2024

recommand products