Pay in installments of $70.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 8 - Sep 13
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Biotinylated LILRA3 His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms LILRA3, ILT6, LIR4, CD85e Accession Q8N6C8 Amino Acid Sequence Gly24 Glu439, with C terminal 8*His&Avi tag
Product Specification
| Species | Human |
| Synonyms | LILRA3, ILT6, LIR4, CD85e |
| Accession | Q8N6C8 |
| Amino Acid Sequence | Gly24-Glu439, with C-terminal 8*His&Avi tag GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGEGGGSHHHHHHHHGLNDIFEAQKIEWHE |
| Expression System | HEK293 |
| Molecular Weight | 68-75kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Biotin |
| Tag | Avi Tag, His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Knight J S. et al. (2017) Activated signature of antiphospholipid syndrome neutrophils reveals potential therapeutic target. JCI Insight. 2(18): e93897. |
Background
Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3) is also known as CD85 antigen-like family member E (CD85e), immunoglobulin-like transcript 6 (ILT-6) belongs to a family of leucocyte receptors. LILRA3 lacks a transmembrane domain and it is highly homologous to other LILR genes, and can bind human leukocyte antigen (HLA) class I. The biologic role of the LILRA3 molecule and the nature of its ligand are not known. LILRA3 can bind with high affinity to the surface of monocytes, leading to abolish LPS-induced TNF-alpha production by monocytes. It can be detected in B-cells, natural killer (NK) cells, peripheral blood monocytes and lung. LILRA3 transcripts are markedly upregulated in neutrophils from patients with antiphospholipid syndrome (APS). Some polymorphisms of the LILR genes are reported to be associated with susceptibility to diseases such as rheumatoid arthritis and multiple sclerosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 7 reviews
Sort
Product Reviews
★★★★★ 5
Great coverage, easy to apply
Color: Glint-Rainbow
This has amazing coverage. Was skeptical at first. I thought the little puffer applicator would not work well. It does however work Very! Well! Would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
★★★★★ 5
Lovely
Color: Silver White - 02, Color: Silver White - 02
This is the best body glitter I have ever owned. I have a spray one and it is not as shiny as this one. This one has a very good appearance. It literally is shining so bright without the lights being off. This is one drop on my hand that I spread around, it does go on as a liquid and then it dries up and soak in your skin . From the bottle It has a very fresh scent like a very, very light scent, but when you put on your skin, it doesn’t smell like anything so you can still put on your regular perfume without worrying about mixing fragrances. It’s a good decent size especially considering I only did one drop and I get so much glitter!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
★★★★★ 5
Perfect Champagne Shimmer for Festivals & Events
Color: Champagne Gold - 01
Color- Champagne Gold shade.
So cute! Get it! I always end up getting compliments when I wear this to festivals/concerts/event. It works great not just on your face but all over your body like arms, chest, shoulders, anywhere you want a little extra glow. It adds a really cute shimmer without being too extreme or over-the-top. I especially like wearing it to festivals or events where there are lots of lights or sunshine, because that’s when it really catches the light and looks the best.
Once it dries, it has more of a matte finish with a soft shimmer rather than looking overly dewy or greasy. The champagne color blends really nicely with my neutral/tan skin tone, so it looks natural while still adding that fun sparkle. It’s a great little addition to any festival or event outfit.
A little bit goes a long way. I’ve probably used this around 20 times already and still have at least half the bottle left. Another huge plus is that it washes off easily and doesn’t flake everywhere or leave glitter all over the floors and counters like some other body glitters I’ve tried. Overall, a great product if you want a subtle but noticeable shimmer! ✨
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026
★★★★★ 5
Buy it!
Color: Champagne Gold - 01
I love the glitter on my body, it stays and is not sticky! But does get everywhere I touch haha
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
★★★★★ 4
LOTS of glitter
Color: Champagne Gold - 01, Color: Champagne Gold - 01
A little goes a long way, one drop is packed with glitter. Also it actually dries to matte finish, not dewy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2025
recommand products
Duh Grow Hair Nourishing Mask
27.20
Cheera Women's Beautiful Hand Embroidered Motif All-Over Straight Silk Kurta Set (CH069K)
37.70
Cheera Pin-tuck Kurta Palazzo Set CH066K
46.01
Asha Sweet Center Aloo Lachcha
10.44
Cheera Hand Block Print Olive Green & Skin Color Straight Kurta With Palazzo (MAAI-070K)
34.35