Pay in installments of $33.75 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 13 - Sep 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP2 His Tag, HumanProduct Specification Species Human Accession P12104 Amino Acid Sequence Met1 Asp132, with C terminal 8*His MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHHHH Expression System E. coli Molecular Weight 16. 5kDa (Reducing) Purity 98% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution
Product Specification
| Species | Human |
| Accession | P12104 |
| Amino Acid Sequence | Met1-Asp132, with C-terminal 8*His MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | 16.5kDa (Reducing) |
| Purity | ＞98% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
FABP2 is expressed solely in the small intestine, and may control development of the small intestine particularly in response to diet. FABP2 null animals were shown to be resistant to high fat diet induced obesity. FABP2 KO mice fed a high saturated fat low fiber diet showed reduced intestinal villi length and increased transit time, as well as decreased goblet cell density and paneth cell number. Epidemiological studies have long shown that the common Ala54Thr FABP2 polymorphism in humans is associated with metabolic syndrome. The Thr54 FABP was shown to have a slightly higher affinity than the Ala54 containing protein, and human fetal intestinal explants showed that subjects with the Thr54 polymorphism had increased levels of chylomicron secretion . Thus while the complete molecular mechanisms linking these biochemical and cellular observations to the population-based observations remain to be revealed, nutritional intervention strategies may prove helpful in treating metabolic syndrome in Ala54Thr carriers.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 27 reviews
Sort
Product Reviews
★★★★★ 5
Perfect Suit Great Quality and Value
Color: Lavender Purple, Size: 6 Years, Color: Lavender Purple, Size: 6 Years
I love at how nice this boys suit turned out. The slim fit gives it a stylish, elegant look, and it makes my nephew look so sharp and grown up. Fit true to size.
The material feels good quality, not thin or cheap, and it’s definitely nicer than I expected for the price. I really like that it comes as a full set, which made things so much easier instead of having to buy down extra pieces. Love the tie and the vest, so cute.
He wore it for a special event and got so many compliments, people couldn’t believe how handsome he looked. It stayed looking neat all day, and he was able to move around comfortably. I could easily see him wearing this again for weddings, church, holidays, or even school pictures.
Overall, it’s a great buy if you want your little guy to look dressed up without spending a fortune. Beautiful boys suit, stylish and elegant, great value and quality. Wash inside out, and air dry.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2025
★★★★★ 5
One of the best suits out there!!
Color: Christmas Green, Size: 8 Years
I am not one who write reviews, so the fact that I'm penning this review you should know. These suits are the best, the sizing, the fit, the quality everything is perfect. I bought for my 3 sons and they all fit well, I was worried about the fit because one of my son is slender but tall so length things would be okay but waist toooo big, with this suit everything was on point. Ages: 13-14(about 5"4-5"5 have a little body wouldn't consider husky) got him size 18,
10-11(slender but a little tall for his age) got him size 14,
9yr old(average height and body size) got him size 8. Can't beat the price and for 6 pieces(pants, vest, jacket, shirt, tie, bowtie)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
★★★★★ 5
Great buy
Color: Champagne, Size: 6 Years
I bought 3 sizes for my sons to wear at our wedding. They are heavy duty quality material. The dress shirts are a little stiff and snug but also great quality. Would buy again 100%
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
★★★★★ 5
Perfect fit!
Color: Lavender Purple, Size: 12 Years, Color: Lavender Purple, Size: 12 Years
It’s perfect! Just get it, like now!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
★★★★★ 5
Great outfit
Color: Mint Green, Size: 8 Years, Color: Mint Green, Size: 8 Years
Got the outfit as shown in picture and my son was so good looking in this suit. We just love it. I bought it for his birthday and he was so handsome in this suit. Thank you for such a cool suit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026