SKU: 90764207451

LRP10 His Tag Protein, Human

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LRP10 His Tag Protein, HumanProduct Specification Species Human Synonyms LRP10, LRP9, MST087, MSTP087 Accession Q7Z4F1 Amino Acid Sequence His17 Lys440, with C terminal 10*His

Product Specification


Species Human
Synonyms LRP10, LRP9, MST087, MSTP087
Accession Q7Z4F1
Amino Acid Sequence His17-Lys440, with C-terminal 10*His HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRKGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 56-66kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Manini A. et al. (2021) Screening of LRP10 mutations in Parkinson's disease patients from Italy. Parkinsonism Relat Disord. 89: 17-21.

Background

Parkinson's disease (PD) is a neurodegenerative disorder characterized by resting tremor, bradykinesia, muscle rigidity, and abnormal gait. Parkinson's disease (PD) belongs to a family of neurodegenerative diseases characterized by alpha-synuclein accumulation in neurons. LRP10 has been associated with PD, Parkinson's disease Dementia (PDD) and Dementia with Lewy Bodies (DLB) by linkage analysis and positional cloning in an Italian family with late-onset PD. The low-density lipoprotein receptor-related protein 10 (LRP10) was recently shown to be a causal gene for PD, and different ethnic cohorts have distinct frequencies and spectrum of LRP10 variants.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90764207451

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Jiewen Wang
Houston, US
★★★★★ 5
a comprehensive guide at the intersection of generative AI and cybersecurity
Format: Kindle
This book blends deep theoretical foundations with practical frameworks and forward-looking strategies. From adversarial risk models to actionable guidance using OWASP Top 10 for LLMs and the NIST AI RMF, it offers both technical depth and operational clarity. What makes it stand out is its balance of academic rigor and real-world CISO insights, providing a holistic perspective on securing GenAI systems. While it leans enterprise-focused, the content remains accessible to security engineers, risk managers, and policy leaders alike. Generative AI Security is a timely and essential read for anyone working to deploy GenAI responsibly—building systems with both power and integrity in today’s fast-evolving threat landscape.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 2, 2025
N
Nader
Lexington, US
★★★★★ 1
Light on substance and heavy on flaws
Format: Paperback
The book has a great list of topics, but fails to provide much substance any of them. Most of the provided code is just comments that avoid the actual crux of the issues being discussed. (e.g. #implement the logic to validate XYZ - while the whole point of this chapter is teach how the heck we validate XYZ!) Some parts are plain wrong, for example the part on Graph based RAG is fundamentally flawed as it assumes the text embedding and the graph embedding are in the same latent space. (This is one of many more examples). Seems like the book was rushed, and the author has limited hands on experience (if any). At least we know based on the amount of flaws that it was not written by an LLM
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025
N
noam barkay
Boise, US
★★★★★ 5
Excellent book to truly understand LLM design patterns
Format: Paperback
I just finished reviewing Ken Huang's pocket book on LLM Design Patterns, and WOW what an amazing resource! This book is excellent if you want to truly understand how to create and enhance intelligent AI language models, all that in your pocket! Ken makes the difficult things seem surprisingly easy, and that's the real MAGIC. - How to prepare your data for training by making it extremely clean. Developing the brains: the practical aspects of training, optimizing, and maintaining your models. - Learn amazing prompting techniques (such as Chain-of-Thought and Tree-of-Thoughts) to improve your AI's reasoning and problem-solving abilities. Learn everything there is to know about RAGs so that your LLM can incorporate outside expertise. - It also delves into creating "agentic" AI that is capable of action and planning (not only simple plan and execute but also enhanced techniques like ReWoo!) Really, this feels like a useful toolkit, so Ken thank you for that resource Thanks, Idan Habler
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2025
R
Ryan Meyer
Birmingham, US
★★★★★ 3
A Broad Overview, But Light on Modern Fine-Tuning
Format: Paperback
I'm currently really interested in fine-tuning LLMs and recently completed my first LoRA-based fine-tuning on a quantized model. I came to this book looking for more detail on fine-tuning. While it touches on the topic, I found the content didn’t quite align with the current state of the field in 2025. Techniques like LoRA, QLoRA, and PEFT weren’t really covered, and the material leaned more toward what I think are older or lower level approaches. That made it harder to connect with what I’m actually working on. That said, when I shifted to other chapters — like the sections on prompt engineering techniques such as Chain of Thought (CoT) and Tree of Thought (ToT) — I found more value. These sections were clearer, and I picked up a few practical insights, like using few-shot examples that walk through the CoT reasoning process. That’s not something I’ve tried before, and I can see how it might help smaller models that struggle with any type of reasoning tasks. Overall, the book feels more like a broad overview of all LLM concepts. For someone exploring many topics across the LLM ecosystem, it offers a wide-ranging introduction. But for readers like me who are actively trying to learn and apply techniques like fine-tuning and quantization, it may leave you wanting up-to-date guidance.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 10, 2025
V
Vineeth Sai
Lexington, US
★★★★★ 5
Great foundation read for security!
Format: Paperback
This book is a great read! It builds a strong foundation and I would highly recommend it for builders who are interetsed in building on LLMs and ensuring everything is secure. Security is super important and this book does it justice!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 27, 2025

recommand products