SKU: 90795619338

Human NFL, His tag

Sale price$99.00 Regular price$110.00
Save 10%

Pay in installments of $27.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 12 - Sep 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NFL, His tagProduct Specification Species Human Synonyms Neurofilament light polypeptide, NF L, 68 kDa neurofilament protein, Neurofilament triplet L protein, NEFL, NF68 Accession P07196 Amino Acid Sequence Protein sequence (P07196, Glu397 Ser472, with C 10*His) ETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 10. 2 kDa Observed MW: 15 kDa Purity 90% by SDS PAGE

Product Specification


Species Human
Synonyms Neurofilament light polypeptide, NF-L, 68 kDa neurofilament protein, Neurofilament triplet L protein, NEFL, NF68
Accession P07196
Amino Acid Sequence

Protein sequence (P07196, Glu397-Ser472, with C-10*His) ETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 10.2 kDa Observed MW: 15 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Neurofilament light polypeptide, also known as neurofilament light chain, abbreviated to NF-L or Nfl and with the HGNC name NEFL is a member of the intermediate filament protein family. The NF-L protein is encoded by the NEFL gene. Neurofilament light chain is a biomarker that can be measured with immunoassays in cerebrospinal fluid and plasma and reflects axonal damage in a wide variety of neurological disorders. It is a useful marker for disease monitoring in amyotrophic lateral sclerosis, multiple sclerosis, Alzheimer's disease, and more recently Huntington's disease. It is also promising marker for follow-up of patients with brain tumors. Higher levels of blood or CSF NF-L have been associated with increased mortality. The release of this protein reflects ongoing axonal loss. Methods used in different studies for NfL measurement are sandwich enzyme-linked immunosorbent assay (ELISA), electrochemiluminescence, and high-sensitive single molecule array (SIMOA).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90795619338

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
TheRealYoshihito
Whiting, US
★★★★★ 5
Dividing the Office
Color: Black, Size: 4' Wide x 6' Tall (Fluted)
The Hush Screen Portable Office Divider has been a game-changer for my workspace. It not only adds a touch of privacy but also beautifully separates the area, creating distinct zones within my office. The divider's design is functional and modern, seamlessly fitting into my decor. Its portability allows me to reconfigure my workspace as needed, adding an element of versatility. Setting it up was a breeze, and it was sturdy enough to stand on its own. If you're looking for an effective way to enhance your office layout, this divider is a fantastic choice. I can definitely recommend it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 11, 2023
J
JJH
Port Orchard, US
★★★★★ 4
Light commercial grade quality
Color: Black, Size: 4' Wide x 6' Tall (Fluted), Color: Black, Size: 4' Wide x 6' Tall (Fluted)
This VERSARE hush screen portable divider appears to be well made and of light commercial grade quality. The lightweight aircraft aluminum frame and black fabric panel aren’t as heavy duty as the commercial grade steel panels of years past, but this panel certainly has adequate durability for home or office use. The sleek modern style is aesthetically pleasing, definitely appropriate for commercial applications, it doesn’t look cheap, or out of place. It’s freestanding and portable, with optional locking wheels, measuring 4’ wide X 6’ tall. The top panel is made of a clear fluted fiberglass, providing a window for natural light to filter through. I’m currently using it in my home office to partition of a separate workspace for my college student. It works very well for my purpose, I now have two relatively private workspaces in one office. It’s fairly easy to assemble, but the instructions could be more detailed and illustrative. One thing that I don’t like about it, is that the legs only slide in place, but they don’t bolt to the frame, allowing the legs to slide out of place when the panel is lifted up. The problem isn’t as magnified with the wheels installed, because the panel is then rolled, rather than lifted. It would be much easier to lift and move if the legs were bolted in place. But since I won’t be moving the divider very often, it’s not a deal breaker. Overall, I’m very pleased with the quality and look of this portable divider. At just under $555, it’s perhaps a tad bit overpriced, but still a reasonably good value. I recommend this VERSARE portable divider for home or office applications.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 29, 2023
P
Paula P.
Fort Morgan, US
★★★★★ 5
Excellent wall partition for separating work desk stations.
Color: Charcoal Gray, Size: 4' Wide x 6' Tall (Fluted)
This Hush Screen Portable Divider has worked perfectly to separate individual desk work spaces in our office environment. The fluted windows allow natural light to cascade in to the space while still allowing work privacy. Very easy to move and light weight so you can easily change your space to your liking. The modern look and design fits our office aesthetic perfectly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2022
M
Michelle Garcia
Waukegan, US
★★★★★ 5
Great for a homeschool room
Color: Black, Size: 4' Wide x 6' Tall (Fluted)
I homeschool my kids and in their school room, I use this to divide between my sons side & my daughters side. Its easy to set up, and is sturdy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 14, 2023
T
Verified Purchase
@toogieblossom
Fort Morgan, US
★★★★★ 5
Best sock I've ever had!
Size: Large, Color: White, Size: Large, Color: White
I have these same socks in white and gray, oh, and a couple of colors, and they are my favorite socks. They're the most comfortable, best-fitting socks I've ever ordered.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 13, 2025

recommand products