SKU: 92213862316

Cyclophilin A His Tag Protein, Mouse

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 10 - Sep 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cyclophilin A His Tag Protein, MouseProduct Specification Species Mouse Synonyms Peptidyl prolyl cis trans isomerase A; PPIase A; SP18; PPIA; CYPA Accession P17742 Amino Acid Sequence Met1 Leu164, with C terminal 8*His Tag MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQLHHHHHHHH Expression System E. coli Molecular Weight 19kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g

Product Specification


Species Mouse
Synonyms Peptidyl-prolyl cis-trans isomerase A; PPIase A; SP18; PPIA; CYPA
Accession P17742
Amino Acid Sequence

Met1-Leu164, with C terminal 8*His Tag MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQLHHHHHHHH

Expression System E.coli
Molecular Weight 19kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Haendler B., et al.,(1987), Complementary DNA for human T-cell cyclophilin. EMBO J. 6:947-950. 2. Haendler B., et al., (1990), Characterization of the human cyclophilin gene and of related processed pseudogenes.Eur. J. Biochem. 190:477-482. 3. Ota T., et al.,(2004), Complete sequencing and characterization of 21,243 full-length human cDNAs.Nat. Genet. 36:40-45.

Background

Peptidyl-prolyl cis-trans isomerase A, also known as PPIase A, Rotamase A, Cyclophilin A, Cyclosporin A-binding protein, PPIA and CYPA, is a cytoplasm protein that belongs to the cyclophilin-type PPIase family and PPIase A subfamily. Cyclophilins (CyPs) are a family of proteins found in organisms ranging from prokaryotes to humans. These molecules exhibit peptidyl-prolyl isomerase activity, suggesting that they influence the conformation of proteins in cells. PPIA / Cyclophilin A accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIA / Cyclophilin A is secreted by vascular smooth muscle cells in response to inflammatory stimuli, and could thus contribute to atherosclerosis. It is not essential for mammalian cell viability. PPIA / Cyclophilin A can interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 92213862316

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Stephen M.
Massapequa, US
★★★★★ 5
A Clear, Readable, and Necessary Contribution
Format: Paperback
This is a clear, readable, and necessary book. The Trinity is the central mystery of the Christian faith, but it can be difficult to articulate in a simple and coherent way. As one who regularly teaches the topic in the Catholic high school setting, I appreciated the very accessible approach that the author takes. Anyone who struggles with the basic meaning of the doctrine would benefit from this text, as would those who are tasked with explaining it to others. From the very first page of the book, the author presents the doctrine of the Trinity through three basic statements: 1. There is only one God. 2. The Father, the Son, and the Holy Spirit is each God. 3. The Father, the Son, and the Holy Spirit are not the same. Besides a very good opening chapter on the ability to speak about God at all, the entire book is basically an unpacking of why the Church came to believe in these three statements and the problems (aka heresies) that arise when any one of the three is denied. Over the course of the book, the reader will become familiar with many of the key biblical texts underlying the doctrine of the Trinity and the early theologians who defended it. While this is not primarily a work of doctrinal history, the arguments are almost entirely based on the thought of these fourth and fifth century theologians. Two points are worth noting, though neither was a "deal breaker" for me: First, be ready for lots of references to popular culture. I was surprised to see mentions of everything from Wayne's World and Borat to the song Achy Breaky Heart and the Three Amigos. These are no doubt great examples from the author's experience, as university teacher, in connecting the subject matter to his student audience. But in almost every instance I found myself drawn away from the topic at hand and in some cases I was left pondering the usefulness of the gratuitous reference itself. Luckily, I got almost every single one--until a late reference to the British TV series Father Ted forced me to look it up on Google. Second, I'm not sure if this book is still in such an early printing that it hasn't been physically typeset yet, but my edition looked as though an inkjet printer produced it. In an age of Retina display screens, it was a bit odd being disappointed in the quality of actual printed text. Overall, I highly recommend the book. I've just ordered the author's previous book from Paulist Press and look forward to his future works.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2015
I
Verified Purchase
ILOVEMYKINDLE
Belleville, US
★★★★★ 4
This book is good if you wish to know the heresies of the ...
Format: Kindle
This book is good if you wish to know the heresies of the Trinity. It does not cover the inner working relationships of the Trinity.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2016
B
Verified Purchase
bevo in the nw
Draper, US
★★★★★ 5
It doesn't have to be a mystery
Format: Paperback
The answer almost every Catholic including the clergy give regarding the Trinity is "its a mystery." Its not if you read Bullivant it is now a discussion and conversation about the Christian understanding of God. Now the person in the pew can help explain "the mystery" to the clergy who haven't read The Trinity. The author introduces the Trinity as "supreme simplicity" and then guides discussion through an adult presentation of a fundamental belief among Christians. The style is very conversational with wonderful and one could say fun examples. The author makes excellent use of scripture and the writings of the early Christian church before all the disputes and splits started. He does it all in about a 100 pages. Perfect for the curious, those wanting a real answer about the Trinity and for small study groups. Finally it is done with an ecumenical approach that allows Christians to dialogue together and with those with different or no faith tradition.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2015
I
Verified Purchase
Ice
Dallas, US
★★★★★ 5
Excellent Introduction
Format: Kindle
Bullivant, as simply and straightforwardly as possible, provides an excellent Introduction to this most central of Christian doctrine in an educated yet graspable format. Highly recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 16, 2023
R
Verified Purchase
Robert Badger
Omaha, US
★★★★★ 5
This book is a good introduction to the theology of the Trinity
Format: Paperback
As a Catholic priest, I am on the lookout for books which may help those who want to delve more deeply into theology. This book is a good introduction to the theology of the Trinity. Professor Bullivant shows why it is biblical. He also explains some of the more difficult terminology very well. Also, his opening chapter provides a memorable explanation of the via negativa in theology. I highly recommend this text.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2017

recommand products