SKU: 93063035635

S100B, Human

Sale price$148.50 Regular price$165.00
Save 10%

Pay in installments of $41.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

S100B, HumanProduct Specification Species Human Accession P04271 Amino Acid Sequence Ser2 Glu92, with N terminal 8*His MHHHHHHHHSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE Expression System E. coli Molecular Weight 11 12 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <2EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized Powder Reconstitution Reconstitute at less than 1 mg mL according to the

Product Specification


Species Human
Accession P04271
Amino Acid Sequence Ser2-Glu92, with N-terminal 8*His MHHHHHHHHSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Expression System E.coli
Molecular Weight 11-12 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

S100B is a small calcium-binding protein in the neuronal system, and belongs to the S100 family. S100B proteins are a family of 25 homologous intracellular calcium-binding proteins characterized by EF hand motifs, low molecular weights (9–13 kDa), ability to form homodimers, heterodimers and oligomeric assemblies, and are characterized by tissue and cell-specific expression.  They are solely present in vertebrates. S100B protein is mainly expressed in the neuronal system such as astrocytes, maturing oligodendrocytes, dendritic cells, and Schwann cells. However, some other cells outside the brain, like kidney epithelial cells, ependymocytes, chondrocytes, adipocytes, and melanocytes, can also express S100B protein.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93063035635

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
NBY
Belleville, US
★★★★★ 5
Elegant and spacious
Color: Beige and Black With Matching Wallet
What a great purse, spacious and elegant. Sturdy, love the studs on the bottom, so it protects from damage. Colors go with most outfits. Well made and great value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
J
Verified Purchase
Judith A. Rockwell
New York, US
★★★★★ 5
My bag for all seasons!
Color: Gold and Black Flower With Matching Wallet
Love it! Stylish. Well made.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
L
Verified Purchase
Laurie Wojcik
Battle Creek, US
★★★★★ 5
Your endless search for a stylish and functional bag ends here
Color: A5 Black and White
About three years ago, I bought this really cute navy blue and white striped handbag at Target and after about a year and a half of faithful service, the cloth lining started to fall apart. Every fiber of my being wanted to buy a new handbag and replace it but since I couldn't find anything I liked, I painstakingly sewed the lining back into place and carried on using the purse until its state of disrepair was beyond anything my novice sewing skills were capable of fixing. This should indicate that I'm not the kind of person who just buys any handbag. I need it to have compartments. I need it to have a zipper that shields the purse's precious contents from the elements. I need it to be able to fit my Chromebook in the event that I'm traveling somewhere and need to bring it along. I need it to have functionality for both the typical workday and for weekend adventures. Lastly, I don't necessarily "need" it to match with most of my work clothes, but it's an added bonus when I can carry a handbag that makes me look effortlessly put together. And here it is. I can tell that this is a handbag that will last me a long time, and I won't need to get out the needle and thread to maintain it. It looks sharp, it's sturdy, it fits everything, and the color I purchased even included a matching wallet. It was a big leap for me to buy a handbag without being able to have that tactile in-store "yes this will work for me" experience so if you're the kind of person who waffles back and forth about buying a handbag sight unseen via an online retailer, worry no more. This is the one. However, a word of caution: If you're looking for something relatively small, this isn't it. This is a carry-everything-get-the-job-done-and-be-practical-and-cute-at-the-same-time type of handbag so if you're looking for something a little more portable, like for a night out, I'd recommend picking a style that includes the matching wallet so you can use it as a wristlet.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2018
I
Verified Purchase
Inquiring Mind
Whiting, US
★★★★★ 4
Beautiful But Heavy
Color: A3 Purple and Black
I bought this bag in black and purple and it's roomy and beautiful. I love how it looks and it's a good-quality, sturdy bag. That said, it's really stiff and heavy. Its weight and rigidity remind me of a briefcase that I carried in the '80s. Also, since it doesn't have any dividers in the middle, it's easy for things to fall to the bottom and get buried. This, however, was easily remedied by buying an insert purse organizer. If you can live with all of that (I can see how some could) it's a great buy. As I mentioned before, it's a very nice, high-quality bag.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 17, 2025
J
Verified Purchase
Johanna
Bozeman, US
★★★★★ 5
Good brand and great price
Color: Beige and Black With Matching Wallet
This brand always has great bags and purses I have a few more by this brand. Very spacious and good price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026

recommand products