SKU: 93469388086

FABP6 His Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 8 - Sep 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP6 His Tag Protein, HumanProduct Specification Species Human Synonyms ILeal Lipid binding protein Accession P51161 Amino Acid Sequence Met1 Ala128, with N terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms ILeal Lipid-binding protein
Accession P51161
Amino Acid Sequence Met1-Ala128, with N-terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

FABP6(ILeal Lipid-binding protein, ILBP) is a cytoplasm protein which belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It binds mainly to bile acids that are reabsorbed in the ileum. Thus, mice lacking FABP6 do not exhibit a fatty acid metabolic phenotype but are protected against gallstone disease. FABP6 is a cancer-related protein that acts as an intracellular transporter of bile acid in the ileal epithelium. FABP6 may also play an important role in early carcinogenesis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93469388086

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Benoit J. Lheureux
Omaha, US
★★★★★ 5
Solid, well-made product. I like that you can rotate-to-mount for different situations.
Size: 6FT, Style: 1 Pack
Heavy-duty chord, heavy-duty sockets, heavy-duty metal frame. Works well, and I like the lighted on/off switch. Being able to rotate and mount however needed makes it versatile. As clearly illustrated in the product description, the sockets are *really* close to each other, but that perfectly met my needs - but look for alternatives if you plan to plug in wall-warts and other space-consuming devices.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 5, 2026
A
Verified Purchase
AlanS
Lowell, US
★★★★★ 5
Before Mounting, Re-look at the photos for bracket position to save frustration!
Size: 3FT, Style: 1 Pack
Good, solid quality feel, fit and finish... BUT, as other comments indicate, the brackets can be confusing. They come positioned inward for compact fit in the box. Remove the mounting screw from the end, then SLIDE the bracket off, position the L-shape away from the strip for mounting and re-insert the power strip. Others mentioned lack of a tool for bracket removal but none is needed, they simply slide off (they don't rotate while seated). I (and others, per the comments) envisioned it mounted with brackets turned inward (as they came in the box) but doing that puts a screw head in the way of fully seating the unit into the bracket with misaligned mounting screw holes. Came back to this ad to look at the pictures and VIOLA -- set the brackets outward and screw holes align for perfect fit! Quite honestly, made me feel like a chimpanzee given a simple puzzle to solve, and I FAILED the test until looking at the pictures! Reading the reviews made me feel a little better, seeing I'm not the only one!! All that said, this power strip provides great bang for the buck. I'm using it to power my desktop computer with a three-monitor display and external storage drives.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
M
Verified Purchase
Mouse
Birmingham, US
★★★★★ 5
Extraordinarily Useful
Size: 10FT, Style: 1 Pack
We use this to plug in all of our chargers (an off brand mini chain saw, off brand mini blower, and way to many (but we love and use them) Ryobi products). The are on a shelf, easy to get to, no cords tangled, no plugging and unplugging. Great decision because this is a great product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 2026
S
Verified Purchase
Saul Ramirez
Massapequa, US
★★★★★ 4
Better for entertainment center
Size: 6FT, Style: 1 Pack
Have it mounted under my workshop desk the mount ability is simple and works good also have my phone plugged in and the ports work good, the length of the cable is good if you want it somewhat far from the outlet only thing is I wish with the design they spaced out the outlets since ryobi’s charging outlets are bricks but other than that zero complaints
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
F
Verified Purchase
F. Rocha
Dallas, US
★★★★★ 5
Perfect Power Strip Outlet!
Size: 6FT, Style: 2 Pack
Perfect! Great Quality. Outlets are spaced closer together, but it has 12 outlets, which is amazing for our needs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026

recommand products