SKU: 94205070077

Human GM-CSF, His tag

Sale price$45.00 Regular price$50.00
Save 10%

Pay in installments of $12.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 10 - Sep 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GM-CSF, His tagProduct Specification Species Human Synonyms Granulocyte macrophage colony stimulating factor, Colony stimulating factor (CSF), Molgramostin, Sargramostim Accession P04141 Amino Acid Sequence Protein sequence(P04141, Ala18 Glu144, with C 10*His) APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 1kDa

Product Specification


Species Human
Synonyms Granulocyte-macrophage colony-stimulating factor, Colony-stimulating factor (CSF), Molgramostin, Sargramostim
Accession P04141
Amino Acid Sequence

Protein sequence(P04141, Ala18-Glu144, with C-10*His) APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical:16.1kDa Actual:17-30kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts that functions as a cytokine. Unlike granulocyte colony-stimulating factor, which specifically promotes neutrophil proliferation and maturation, GM-CSF affects more cell types, especially macrophages and eosinophils. It is part of the immune/inflammatory cascade, by which activation of a small number of macrophages can rapidly lead to an increase in their numbers, a process crucial for fighting infection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 94205070077

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gregory James Walker
Waukegan, US
★★★★★ 5
Excellent shoes.
Size: 11, Color: Black
Exceptionally comfortable and stylish. Great with casual slacks or jeans. If you have a casual work space or casual Fridays, these will be great. Good support. Good fit. Sizes are accurate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
L
Verified Purchase
lgutz57
Charlottesville, US
★★★★★ 5
Nice shoe, sizing information on this review
Size: 9, Color: Grey, Size: 9, Color: Grey
Ok, let's talk Breeze Mesh Sneakers by Bruno Marc (Grey)...... Firstly, they are nicely stylish appearance wise. They are lightweight (which I like). They feel comfortable and easy to walk in. I have not owned them very long, so I can't inform you on long term wear or how they feel after months of use. I own many pairs of shoes, mostly running type shoes. I needed a pair like these to wear in a more formal situation. Maybe with some dress pants or nice jeans. Now let's discuss the SIZING which is very important to me. Without a good fit, your shoes will never feel right when wearing. I normally wear size 9 in Men's. I seen someone mention that they 'run small'. I can do 9.5 in those situations, so I ordered 9.5. When they arrived and I tried them on, it was obvious they were too big. too much toe room in front. So I returned them for my normal size which is 9 Men's. Much better. AND, i still have toe room in front (no tightness). My suggestion to you is to order your normal size. The shoes feel like quality shoes and I feel that are a good purchase (for the price). The shoes came quickly. Bruno Marc is a good overall shoe. Hope this information helps.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
S
Verified Purchase
Sean Farley
Dallas, US
★★★★★ 4
These shoes adequately do the job they're meant to do
Size: 11, Color: Black, Size: 11, Color: Black
For shoes to wear daily for work, these are absolutely perfect. I give four stars simply because they are not 100% perfect; that is, they are a reflection of their cost and durability. With that said, these shoes are perfect for my role as a professor AND a person who walks half a mile from the train station to class and back 5x a week. Comfortable. Nice cushion on the heel. And they look really amazing - classy but not pretentious. I bought a second pair a week after the first just so I could have different colors, and it is likely I will get a third pair. For $40-ish dollars, they do the job they're meant to and they do it well. This picture shown are the originals I bought, but I also got the black pair, too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
F
Verified Purchase
FTL
Lexington, US
★★★★★ 5
Great shoes
Size: 10.5, Color: Dark Grey
I saw people wearing shoes like this in the office (maybe not the same brand), so I ordered a pair to see how they feel. They feel amazing. It's basically sneaker that look ok to be worn with pants and sport jacket. Fit is great, I ordered my usual size and they fit nicely. Sole is thick enough to make them comfortable, not too thick to looks like a sport sneaker. Durability seems ok, wore them couple of times, so I can't really tell, but they seems like they can last long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
K
Verified Purchase
Ken
Los Angeles, US
★★★★★ 5
Love these shoes
Size: 9.5, Color: Grey
These shoes are soft, comfy, and easy on and off. They breathe in the summer heat and feel good on a cool evening. They run true to size and the colors are like they are represented. I recommend this brand for a good looking, inexpensive shoe.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026

recommand products