SKU: 94219472517

Human CD28, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD28, His tagProduct Specification Species Human Synonyms TP44 Accession P10747 Amino Acid Sequence Protein sequence (P10747, Asn19 Pro152, with C 10*His) NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Predicted MW: 16. 8 kDa Observed MW: 33 43 kDa Purity 95% by SDS PAGE Tag with C 10*His Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms TP44
Accession P10747
Amino Acid Sequence

Protein sequence (P10747, Asn19-Pro152, with C-10*His) NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Predicted MW: 16.8 kDa Observed MW: 33-43 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD28 (Cluster of Differentiation 28) is one of the proteins expressed on T cells that provide co-stimulatory signals required for T cell activation and survival. T cell stimulation through CD28 in addition to the T-cell receptor (TCR) can provide a potent signal for the production of various interleukins (IL-6 in particular). CD28 is the receptor for CD80 (B7.1) and CD86 (B7.2) proteins. CD28 is the only B7 receptor constitutively expressed on naive T cells. As a homodimer of two chains with Ig domains binds B7 molecules on APCs and it can promotes T cells proliferation and differentiation, stimulates production of growth factors and induces the expression of anti-apoptotic proteins. CD28 has also been found to stimulate eosinophil granulocytes where its ligation with anti-CD28 leads to the release of IL-2, IL4, IL-13 and IFN-γ.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 94219472517

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
sues Kindle
Grantham, US
★★★★★ 5
Cloudmusic tote
Color: Blue Flowers in Black
I LOVE this bag! I bought it for use as a purse. I carry ALOT of stuff in my purse & after my Vera Bradley purse bit the dust, I couldn't find another one to replace it. This new purse is perfect! Nylon straps that aren't going to fray like the VB purse straps did,,, plenty of room for all my stuff,, infact more room than my old purse had. Made of nylon so it can be washed & the print is absolutely beautiful. I've already gotten many compliments on how pretty it is. It also came sooner than I was expecting it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2025
N
Verified Purchase
Neena Jha
West Palm Beach, US
★★★★★ 4
Beautiful and spacious and light weight bag,
Color: Vintage Red Flowers
The bag is beautiful and spacious and delivered in time. But wish would have got more colors instead of black and red.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 4, 2026
O
Verified Purchase
Ophelia
Port Orchard, US
★★★★★ 5
Functional Beauty!
Color: Mystery Blosoom
I am so happily surprised as to how beautiful this bag is. The quality is fantastic and it is true to the description. I got the Mystery Blossom that looks like a Midnight Beauty to me. It has all the pockets it describes and the side ones are great with elastic holding your bottle or whatever you may use them for very securely. so it is very functional. I know you would be happy to have one or morey ourself. it is very lightweight so you can put alot in it like a laptop or tablet without it weighing you down. You can use it as a shoulder/crossboday bag or carry like a tote bag. I just love it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
K
Verified Purchase
KL
San Leandro, US
★★★★★ 1
Nice size, lots of pockets…doesn’t last.
Color: White Daisy in Black
At first, when I purchased it in May, the only thing I didn’t like was the useless middle zipper inside of the middle main pocket. But the rest of this purse bag is awesome! Well… after 3.5 months, ALL of the inside stitching has come undone. Put something in what you think is the pocket, it’s not a pocket… it is between the lining somewhere. All of the zippers get stuck on the threads that are from the lining. Cute fabric, but that’s all you’ll get… cute fabric.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 25, 2024
M
Verified Purchase
My Country
Massapequa, US
★★★★★ 5
Good quality, GREAT price, many features
Color: Vintage Sunflowers
I was searching for an inexpensive handbag (tote) like this in brand names. The prices were unforgiveable and just crazy! As I was searching on Amazon Prime, this handbag came up. It is really pretty and has ALL the features that I was looking for: Several pockets inside and out, very attractive design for Fall, AND a good price. My only concern/complaint would be that there are more zippers than I would have liked, slip pockets for glasses and phone are my preference. A long strap is included for shoulder wear; it is made of light weight material and washable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 11, 2025

recommand products