SKU: 94468340388

Human CD36, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 18 - Sep 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD36, His tagProduct Specification Species Human Synonyms Glycoprotein IIIb, PAS IV, PAS 4, Platelet glycoprotein IV Accession A4D1B1 Amino Acid Sequence Protein sequence(A4D1B1, Gln35 Asn439, with C 10*His)

Product Specification


Species Human
Synonyms Glycoprotein IIIb, PAS IV, PAS-4, Platelet glycoprotein IV
Accession A4D1B1
Amino Acid Sequence

Protein sequence(A4D1B1, Gln35-Asn439, with C-10*His)
QKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:47.7kDa Actual:70-95kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The CD36 antigen is an integral membrane protein found on the surface of many cell types in vertebrate animals. It imports fatty acids inside cells and is a member of the class B scavenger receptor family of cell surface proteins. CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. The protein itself belongs to the class B scavenger receptor family which includes receptors for selective cholesteryl ester uptake, scavenger receptor class B type I (SR-BI) and lysosomal integral membrane protein II (LIMP-II).CD36 has also been implicated in hemostasis, thrombosis, malaria, inflammation, lipid metabolism and atherogenesis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 94468340388

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sandy
Bozeman, US
★★★★★ 5
Sturdy, great value, very utilitarian
Size: 50 Count
Exactly what I wanted. Exact quality thickness and sturdiness. Only small downside is they're coated in a wax like substance and stick together so you have to pry them apart and if you microwave something, it tends to meld together and also stick into the bowl. But I still love them especially the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
M
Verified Purchase
Mike
Phoenix, US
★★★★★ 5
Great bowl , great. For water boiling 100%
Size: 50 Count
Finally a microwavable bowl, that doesn't rot when boiling water !!! Yay. Great for oatmeal and soups
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
S
Verified Purchase
Sheri Lynn
Cuba, US
★★★★★ 5
Excellent
Size: 50 Count
Amazon Basics Ultra Paper Bowls, 20 oz, are a practical choice for anyone needing disposable bowls for everyday use or special occasions. Whether you're hosting a casual get-together, packing lunches, or simply want an easy cleanup option after a meal, these bowls offer a convenient solution. They are sturdy enough to hold both hot and cold foods without bending or leaking, which makes them versatile for soups, salads, snacks, and more. One of the standout features is their generous 20-ounce capacity, providing ample space for a satisfying portion. The bowls have a simple, clean design that fits well in any setting, from picnics to office lunches. Users appreciate their durability and the fact that they are lightweight and easy to stack, saving storage space. Additionally, being disposable, they eliminate the hassle of washing up, which is always a plus for busy households or events. Overall, these Amazon Basics paper bowls deliver solid performance at a budget-friendly price. They strike a nice balance between functionality and convenience, making them a reliable choice for anyone looking to simplify mealtime cleanup. If you want disposable bowls that handle a variety of foods without fuss, these are definitely worth considering.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2026
G
Verified Purchase
Gabriella
Lake Worth, US
★★★★★ 5
These paper bowls are actually really sturdy for disposable bowls!
Size: 50 Count, Size: 50 Count
These paper bowls are actually really sturdy for disposable bowls! We use them for everything from cereal and soup to quick toddler meals, and they hold up well without getting soggy or flimsy. I also love that they’re microwave safe, which makes busy days a little easier. Great quality for the price and always handy to keep stocked at home!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
A
Verified Purchase
Amber
Los Angeles, US
★★★★★ 5
My paper bowls of choice.
Size: 50 Count
I have been a return buyer of these bowls and amazon basics plates, as they are sturdy and well made, even for liquids. I think there is a generous quantity for the price. I use for my to go meals on the way to work, so I dont have my whole kitchen accumulating in my car. They are good sized and you can fit a decent serving. Will keep buying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026

recommand products