SKU: 95793461963

Rat IgG kappa A, His tag

Sale price$101.25 Regular price$112.50
Save 10%

Pay in installments of $28.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat IgG kappa A, His tagProduct Specification Species Rat Synonyms Ig kappa chain C region, A allele Accession P01836 Amino Acid Sequence Protein sequence (P01836, Ala1 Cys106, with C 10*His) ADAAPTVSIFPPSMEQLTSGGATVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNRNECGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 4 kDa Observed MW: 15, 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Rat
Synonyms Ig kappa chain C region, A allele
Accession P01836
Amino Acid Sequence

Protein sequence (P01836, Ala1-Cys106, with C-10*His) ADAAPTVSIFPPSMEQLTSGGATVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNRNECGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.4 kDa Observed MW: 15, 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. IgG molecules are created and released by plasma B cells. Each IgG antibody has two paratopes. Antibodies are major components of humoral immunity. IgG is the main type of antibody found in blood and extracellular fluid, allowing it to control infection of body tissues. By binding many kinds of pathogens such as viruses, bacteria, and fungi, IgG protects the body from infection. IgG antibodies are large globular proteins made of four peptide chains; two identical γ (gamma) heavy chains of about 50 kDa and two identical light chains of about 25 kDa. light chain (L chain) refers to the small molecular weight peptide chain in immunoglobulin. According to its structure and the antigenicity of the constant region, it is divided into two types: kappa light chain and lambda light chain.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95793461963

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Evalynn Janes
Battle Creek, US
★★★★★ 5
it came in pristine condition
Size: 128GB, Style: Wi-Fi, Color: Silver
When i bought this ipad, i expected nothing, and i got everything. The screen came in pristine condition with a wrap over it, and not a single dead pixel, and holy crap man the BATTERY LIFE? 62 full-to-empty cycles is a golden goose in terms of cycle count for a 1 year old ipad. I cannot tell you enough how good my case was with this reseller. Please though, if you do buy used, make sure you record your experience unboxing, but by all means give them a go, my experience was amazing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
N
Verified Purchase
Nika S
Natrona Heights, US
★★★★★ 5
Nice new iPad for $100 less than retail
Size: 128GB, Style: Wi-Fi, Color: Silver
Arrived on time. Well packed in excellent condition. This is a great update to an old iPad that was 6 years old. Faster with nice crisp screen quality. Good battery life. We put on a glass screen protector and got a case for it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 30, 2025
A
Verified Purchase
Amazon Customer
Louisville, US
★★★★★ 5
ipad
Size: 128GB, Style: Wi-Fi, Color: Silver
i love it so much, it came in a timely manner. wasn’t broken or damaged. works great a few months in so far with it no problems
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
A
Verified Purchase
Amazon Customer
Dallas, US
★★★★★ 5
Great Value!
Size: 128GB, Style: Wi-Fi, Color: Silver
My son broke his previous iPad so he had to chip in for his next one and this was the perfect compromise. It’s lightweight and the battery lasts longer than his last iPad. We bought the silver and it’s a nice color. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
R
Verified Purchase
Rebekah Evans
Battle Creek, US
★★★★★ 4
great product, not the best price.
Size: 128GB, Style: Wi-Fi, Color: Blue
Good product, my husband was super excited with it for Christmas. It came in pristine condition and I absolutely love that it was repackaged just like a brand new iPad! Great product but giving it 4 stars because I found non refurbished ones for a similar price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2025

recommand products