SKU: 9596224119

Her3 His Tag Protein, Human

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 8 - Sep 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Her3 His Tag Protein, HumanProduct Specification Species Human Synonyms Her3, FERLK, LCCS2, VSCN1 Accession P21860 Amino Acid Sequence Ser20 Thr643, with C terminal 10*His

Product Specification


Species Human
Synonyms Her3, FERLK, LCCS2, VSCN1
Accession P21860
Amino Acid Sequence

Ser20-Thr643, with C-terminal 10*His SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

80-95kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Zhang N. et al. (2016) HER3/ErbB3, an emerging cancer therapeutic target. Acta Biochim Biophys Sin. 48(1): 39-48.

Background

HER3 is a member of the HER (EGFR/ErbB) receptor family consisting of four closely related type 1 transmembrane receptors (EGFR, HER2, HER3, and HER4). HER receptors are part of a complex signaling network intertwined with the Ras/Raf/MAPK, PI3K/AKT, JAK/STAT, and PKC signaling pathways. Aberrant activation of the HER receptors and downstream signaling molecules tips the balance on cellular events, leading to various types of cancers. The HER3 protein is expressed in several types of tumors. That fact, together with the role of HER3 in promoting cell proliferation, implicate that targeting HER3 may have therapeutic relevance. Furthermore, expression and activation of HER3 has been linked to resistance to drugs that target other HER receptors such as agents that act on EGFR or HER2.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9596224119

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sheila Cash
Charlottesville, US
★★★★★ 1
Wobbly and Poor Design
Size: 1-Panel
Update: nope! Not worth the money. My cat simply brushed against the divider, and it fell, knocking breakable things over. Not safe! It serves it's purpose, but...the screws were basically glued to the packaging. It took me longer to get the screws out of the packaging than it did to put it together. The assembly was easy. I am not mechanically inclined by any means, but the instructions, despite being very hard to read (I have over 40 eyes), were pretty simple. Structurally, it is very wobbly. I think they should have designed it with a middle rod to keep it more stable. I find that the attachments to the rods are wobbly and should have been screwed rather than popped into an attachment hole without reinforcement. That would have also made the room divider more stable. I have cats, but the material is easy to clean. I took a damp cloth to it, and it came right off. As far as see-through...I think it does a great job of masking theO other side of the room.. I just wish it was a little longer and closer to the floor stand. I like that it came with extra parts. It's just a very cheaply made item, and I don't think the price for the item reflects how cheaply it is made, how wobbly and unstable it is, or the poor design.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2025
D
Verified Purchase
David T Stark
Pawtucket, US
★★★★★ 5
Very good room divider
Size: 6-Panel
I ised this to isolate a storage area in my apartment. Looks better than boxes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 22, 2026
J
Verified Purchase
Jodie
Grantham, US
★★★★★ 3
Taking forever but worth it
Size: 1-Panel, Size: 1-Panel
Love the product. However, trying to take the screws etc out of its box, it’s almost impossible due to the adhesive inside it. I have neck and arm issues so for me it was even more difficult. Adhesive stuck to each washer and screw so I had adhesive all over my hands then I had to get it off of the items.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2025
O
Verified Purchase
OkieDokie
Lake Worth, US
★★★★★ 5
Stable, solid, and versatile!
Color: Black, Size: 8 Panel-176'' Wide, Color: Black, Size: 8 Panel-176'' Wide
Exceeded my expectations. Easy, but tedious to assemble. That said, it’s solid, well made, and will last. You can stand it up in a straight line without concern it will fall over. No need to fold it like an accordion for stability. Helped me separate my garage gym from the kids bikes, shelving, paint, tools, and typical garage stuff.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 13, 2025
M
Verified Purchase
Magical M
Los Angeles, US
★★★★★ 5
Awesome !!
Color: Black, Size: 8 Panel-176'' Wide
This Divider is absolutely as advertized and works perfectly !! The quality is outstanding and the set up is easy to understand. Perfect !!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026

recommand products