SKU: 97418107775

GABARAPL2 His Tag Protein, Human

Sale price$182.70 Regular price$203.00
Save 10%

Pay in installments of $50.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 8 - Sep 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GABARAPL2 His Tag Protein, HumanProduct Specification Species Human Synonyms ATG8L, ATG8C, GATE 16, GATE16, GEF 2, GEF2 Accession P60520 Amino Acid Sequence Met1 Phe117, with N terminal 8*His Tag MHHHHHHHHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF. Expression System E. coli Molecular Weight 17kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms ATG8L, ATG8C, GATE-16, GATE16, GEF-2, GEF2
Accession P60520
Amino Acid Sequence

Met1-Phe117, with N-terminal 8*His Tag MHHHHHHHHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF.

Expression System E.coli
Molecular Weight 17kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Ewing Rob M, et al. (2007) Large-scale mapping of human protein-protein interactions by mass spectrometry. Mol Syst Biol. 3(1):89. 2. Okazaki N, et al. (2000) Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain: possible role of vesicular transport in axonal elongation. Brain Res Mol Brain Res. 85(1-2):1-12. 3. Xin Y, et al. (2001) Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein. Genomics. 74 (3):408-13.

Background

GATE-16, also known as ATG8, belongs to the MAP1 LC3 family. It is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. GATE-16 is expressed at very low levels in lung, thymus and small intestine. GATE-16 is involved in intra-Golgi traffic. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97418107775

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kindle Customer
Louisville, US
★★★★★ 5
Heals chapped, dry lips Fast
Amazing restorative lip balm. Dry, chapped lips healed in a few hours!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
K
Verified Purchase
Kelly C.
Dallas, US
★★★★★ 5
The best lip balm!
I’m so addicted to this lip balm!!! If you have secret chapped lips this will fix it in a day or two!!! And even if u don’t, it keeps your lips soooo soft!!! A bit pricey but it goes on sale a lot so watch for that.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2025
L
Verified Purchase
Laureleaves
Lake Worth, US
★★★★★ 4
Amazing product but star down on price
I desperately needed a healing lip balm for my perpetually chapped and scarred lips, and at first was skeptical that this was nothing but a glorified aquaphor, which works well enough for me but I was curious about better treatments. After some weeks of regular use, my lips feel incredible. I am sold. I only wish two things: that it was a smidgen cheaper, and that there was a version with SPF so I could have one to wear out during the day and have it’s magic working all the time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2024
L
Verified Purchase
LA and BM
Los Angeles, US
★★★★★ 5
Fantastic for rosacea, PD, atopic dermatitis, dry skin
I’ve been using this for close to a year and it is amazing for my super sensitive and dry skin. I have perioral dermatitis, atopic dermatitis, and rosacea and live in Minnesota with bitter cold and the heater running over half the year. Cicalfate cream doesn’t flare any of these and it helps reduce redness and completely resolves dry skin. I use about a pea size amount AM and PM,, apply to dry skin, massage in, then mist with the Avene thermal water spray. Although the cream is thick, the slight white cast absorbs within a few minutes. I do not wear foundation so I don’t know how this affects it.it doesn’t burn my eyes and I’m a contact lens wearer. A big tube of cream lasts me the better part of a year.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 28, 2025
P
Verified Purchase
P. Lau
Pawtucket, US
★★★★★ 5
Great for harsh winters
I was recommended this product by ChatGPT as an effective and safe product that my wife (who is currently nursing) can use. We have been very mindful of certain additives and chemicals in our products and this was able to meet our requirements. Separately in the harsh winter in the northeast, this has been extremely effective in protecting the lips
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2026

recommand products