SKU: 9800337854

CD7 His Tag Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 25 - Sep 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 His Tag Protein, HumanProduct Specification Species Human Antigen CD7 Synonyms CD7, GP40, TP41, LEU 9, Tp40 Accession P09564 Amino Acid Sequence Ala26 Pro180, with C terminal 8*His AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 30 35kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His

Product Specification


Species Human
Antigen CD7
Synonyms CD7, GP40, TP41, LEU-9, Tp40
Accession P09564
Amino Acid Sequence

Ala26-Pro180, with C-terminal 8*His AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

30-35kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Sempowski G D. et al. (1999) Resistance of CD7-deficient mice to lipopolysaccharide-induced shock syndromes. J Exp Med. 189(6): 1011-1016.

Background

CD7 is a 40-kD member of the Ig gene superfamily that is expressed on a major subset of human peripheral T lymphocytes and NK cells. CD7 is an early T cell activation antigen in that CD7 mRNA levels rise within 15 min after initiation of a transmembrane calcium ion flux. CD7 can complex with CD3 and CD45 molecules, and CD7 signaling involves both protein kinase C and protein tyrosine kinase. CD7 has been shown to be a functional signal-transducing molecule on resting NK cells. Antibody cross-linking of NK cell CD7 induced increases in free cytoplasmic calcium, secretion of IFN-γ, NK cell proliferation, adhesion to fibronectin, and NK cytotoxic activity. Although the above studies have demonstrated in vitro roles for CD7 in T and NK cell activation and/or adhesion, relevant functions of CD7 in vivo remain unknown.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9800337854

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lucie P
Waukegan, US
★★★★★ 4
Durable, Dogs love it
Color: Red
My Frenchie is a crazy chewer and can chew up a nylabone in a day, so I was looking for something that would last longer. So far this is holding up, and is pretty durable. Both my dogs like it a lot, it’s easy for them to grasp, and chewable but still very tough material. I suspect at some point it’ll wear down, but not for a while. The size was just as described / expected. Not too small and not too big
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2025
A
Verified Purchase
Amazon Purchase
Omaha, US
★★★★★ 5
Great for aggressive chewers!
Color: Blue
Our aggressive chewers love these! Very durable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026
O
Verified Purchase
Ozark Matt-Man
Lowell, US
★★★★★ 3
NOT FOR PLAYING CATCH.
Color: Blue
This toy is quite heavy, making it good for a chew toy or for fetch, but not for catch. It could very easily injure your dog as it damned near did mine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
E
Verified Purchase
e callie
Carnegie, US
★★★★★ 5
Peanut butter delivery system
Color: Blue
My big dog loves this bone. I run PB down the middle on one side when we go out. He loves it and brings the bone to us when we return to play :gimme that bone.”
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
P
Verified Purchase
Pam’s Product Picks
Phoenix, US
★★★★★ 4
Durable bone that you can add a spreadable treat to
Color: Blue
Our German Shepherd was 4 months old when we purchased this. She’s going to be 6 months soon. She has been teething really bad. We wanted some way to sooth her pain. This product was just what we needed. We put it in the freezer with some peanut butter in the center on both sides. Once frozen we give to our puppy. She loves it. When we open the freezer she recognizes the ziplock package that it was delivered in which we store it in our freezer. She jumps around until we give it to her. She loves it and it keeps her occupied for a while. It is very durable. I did not notice any smell when we received it. It does not make any noise. The plastic material is safe for animals. To clean I put in the dishwasher. The only reason I did not give it 5 stars is because sometimes the peanut butter gets stuck in it and may need to go through the dishwasher twice which is not a big deal. Or you can hand wash it. I found the dishwasher was best for us. You do not even have to put anything on it, but our pup likes it. I would recommend to others.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 15, 2025

recommand products