SKU: 99389818723

SARS-CoV-2 (JN.1/Omicron) RBD (V483), His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 18 - Sep 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SARS-CoV-2 (JN.1/Omicron) RBD (V483), His tagProduct Specification Species SARS CoV 2 Synonyms Spike glycoprotein, E2, Peplomer protein Accession P0DTC2 Amino Acid Sequence Protein sequence (P0DTC2, Arg319 Lys537, with C 10*His) RVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIKGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYWYRSFRKSKLKPFERDISTEIYQAGNKPCKGVKGPNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH Expression System HEK293 Molecular

Product Specification


Species SARS-CoV-2
Synonyms Spike glycoprotein, E2, Peplomer protein
Accession P0DTC2
Amino Acid Sequence

Protein sequence (P0DTC2, Arg319-Lys537, with C-10*His) RVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIKGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYWYRSFRKSKLKPFERDISTEIYQAGNKPCKGVKGPNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 26.6 kDa Observed MW: 33-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

There are many variants of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the virus that causes coronavirus disease 2019 (COVID-19). BA.2.86 was designated as a variant under monitoring by the World Health Organization on 17 August 2023. JN.1 (sometimes referred to as "Pirola"), a subvariant of BA.2.86 Omicron, emerged during August 2023 in Luxembourg. On 19 December 2023, JN.1 was declared by the WHO to be a variant of interest independently of its parent strain BA.2.86, but overall risk for public health was determined as low. Sars-cov-2 infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 99389818723

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
R. Heart
Grantham, US
★★★★★ 4
Good companion to a coffee setup
This electric frother is a great companion to have in a kitchen/coffee setup and I've been using it to mix my morning coffee. The frother includes a stand which serves as the charging base and multiple attachments (likely won't really see too much use realistically). My only downside is that the stand situation is a bit lackluster as the wireless charging feature requires you to line up the two pins at the top to the stand and balance the frother. Alternatively the frother also has a USB C charging port (sadly not USB C compliant as it can't be charged via USB c to c). The frother itself cycles between different levels of speed when you press the button and it is pretty strong; being able to very easily swirl and mix large amounts of coffee leaving mine nice and frothy. I've also been using this to mix drink powder mixes to great effectiveness. The other attatchments don't really hold too much value to me (other than maybe the whisk for eggs) but is nice to have other options included. Overall this frother is a massive step up over me using a spoon to stir my coffee.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
U
Uncle Vinny
Bozeman, US
★★★★★ 5
My coffee is now judging your coffee.
I’m a simple man. All I wanted was decent foam on my morning coffee without paying $7 at Starbucks like a sucker. What I got instead is this charcoal black, LED-equipped, triple-whisk, rocket-powered milk frother that feels like it should have a NASA logo on it. This thing has three speeds and an actual digital battery display. I caught myself staring at the 1% accuracy battery percentage like it was the stock market. “We’re at 87%… we’re still frothing kings today.” The magnetic charging dock is so satisfying it should be illegal. I literally say “goodnight” to it when I put it back on the stand. The spring whisk? Velvety microfoam so perfect my wife asked if I was having an affair with a barista. The balloon whisk made whipped cream so fluffy my kids thought it was a cloud that fell into their hot chocolate. And the hook whisk? Blended my protein shake with zero lumps, a miracle previously only achieved by professional athletes and people with patience. Battery life is ridiculous. I’ve been using it twice a day for two weeks and it’s still at 64%. This frother could survive a zombie apocalypse better than I could. The only real downside? I now judge other people’s coffee foam in public. Saw a sad flat latte the other day and whispered “that man doesn’t own the Dropology frother…” If you like coffee, matcha, hot chocolate, or just feeling like a kitchen god, buy this immediately. It’s the most over-engineered $30-ish gadget I’ve ever loved. 10/10 would froth again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
S
SusieFun
Chelsea, US
★★★★★ 5
Powerful and I love the charging base and attachments
This is surprisingly more powerful than I thought it would be. It will whip up an egg for scrambled eggs as well as froth your milk. It came with 3 attachments and a charging base. You can charge it using the base or directly in to the frother using the included usbc. I have had battery operated frothers that really weren't that great. This one is blows them all away. I use it mainly to stir my coffee and scramble my eggs and I'm sure I will find many more ways to use it. Its a great value and looks nice on my counter top.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
C
Compelled to write a review
Massapequa, US
★★★★★ 3
Can't turn it off quickly. Charging stand falls over easily.
This Electric Milk Frother Handheld: Wireless Starlight Black comes with three stainless steel mixer attachments, a charging cable, and a stand that holds the frother with magnets. The attachments are friction fit, they are easy to change and stay securely in place. The frother has three speeds, the speed changes by pressing the On button. Which is why I deducted one star. The problem is you can not turn the frother off quickly. You have to either cycle through the speeds, or hold the button for 2 seconds. When making a chocolate drink, I could not turn the frother off when my drink was about to spill and it made a mess. I recommend getting a frother with a momentary on off button that you hold down to keep it running and let off to stop it. I removed a second star because the base of the charger is narrow and light making it easy to fall over. It has to be taped to the counter with double sided tape.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
J
JPBIZSPACE
Dallas, US
★★★★★ 5
Impressive Power and Convenience Right Out of the Box
I just got this electric milk frother, and after only a few uses I’m already impressed. It has strong, consistent power that turns milk into smooth, velvety foam in seconds — perfect for lattes, cappuccinos, or even mixing matcha. The LED display is a surprisingly premium touch, making it easy to see and switch between speeds. The fact that it’s rechargeable is a huge plus, and the 3‑in‑1 attachments give it more versatility than most handheld frothers. The charcoal black finish looks sleek and modern, and the build feels solid so far. Even with just a handful of uses, it’s clear this frother delivers great performance and convenience. A fantastic little upgrade to any coffee routine — definitely a 5‑star start.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026

recommand products