SKU: 99976638778

Axl His Tag Protein, Mouse

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 8 - Sep 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Axl His Tag Protein, MouseProduct Specification Species Mouse Synonyms Axl, UFO, Tyro7, JTK11, ARK Accession Q00993 Amino Acid Sequence His20 Pro443, with C terminal 10*His

Product Specification


Species Mouse
Synonyms Axl, UFO, Tyro7, JTK11, ARK
Accession Q00993
Amino Acid Sequence His20-Pro443, with C-terminal 10*His HKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 60-78kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Weinger J G. et al. (2011) Loss of the receptor tyrosine kinase Axl leads to enhanced inflammation in the CNS and delayed removal of myelin debris during Experimental Autoimmune Encephalomyelitis. J Neuroinflammation. 8: 49.

2、Linger R M. et al. (2010) Taking aim at Mer and Axl receptor tyrosine kinases as novel therapeutic targets in solid tumors. Expert Opin Ther Targets. 14(10): 1073-1090.

3、Cavet M E. et al. (2010) Gas6-Axl pathway: the role of redox-dependent association of Axl with nonmuscle myosin IIB. Hypertension. 56(1): 105-111.

4、Rankin E B. et al. (2010) AXL is an essential factor and therapeutic target for metastatic ovarian cancer. Cancer Res. 70(19): 7570-7579.

Background

AXL Receptor Tyrosine Kinase is also known as Tyrosine-protein kinase receptor UFO, which belongs to the protein kinase superfamily, Tyr protein kinase family and AXL/UFO subfamily. Mature human Axl consists of a 426 aa extracellular domain (ECD) that contains two Ig-like domains and two fibronectin type III domains, a 21 aa transmembrane segment, and a 422 aa cytoplasmic domain that includes the tyrosine kinase domain. In the nervous system, Axl and its ligand Growth-arrest-specific protein 6 (Gas6) are expressed on multiple cell types. Axl functions in dampening the immune response, regulating cytokine secretion, clearing apoptotic cells and debris, and maintaining cell survival. Axl is upregulated in various disease states, such as in the cuprizone toxicity-induced model of demyelination and in multiple sclerosis (MS) lesions, suggesting that it plays a role in disease pathogenesis. The receptor tyrosine kinase (RTK) AXL has been associated with poor prognosis in numerous malignancies and the emergence of therapy resistance. Upon binding to its ligand GAS6, AXL regulates cell signaling cascades and cellular communication between various components of the tumor microenvironment, including cancer cells, endothelial cells, and immune cells. Converging evidence points to AXL as an attractive molecular target to overcome therapy resistance and immunosuppression, supported by the potential of AXL inhibitors to improve ICI efficacy. Axl contributes to cell survival, migration, invasion, metastasis and chemosensitivity justify further investigation of Axl as novel therapeutic targets in cancer. The soluble AXL receptor as a therapeutic candidate agent for treatment of metastatic ovarian cancer.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 99976638778

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Robert Vanderpol
Houston, US
★★★★★ 5
Men’s body wash
Smells nice and fresh
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2026
S
Verified Purchase
Sully Cortez
Whiting, US
★★★★★ 5
The best hand soap bars PERIOD.
Size: 3.5 Ounce (Pack of 3), Size: 3.5 Ounce (Pack of 3)
Wow! I am actually VERYYYY impressed with this soap. Believe me when I tell you I have tried everything from $5 for 6 bars soap to $50 for 1 bar soap (not an exaggeration). And I can wholeheartedly say this is the absolute best bang for your buck when it comes hand washing/soap. To me these little bars are absolutely awesome for hand washing. I use the scrubby bar when I have a ton of grease after eating say pizza or something & and then I use the moisturizing bars for all other hand washing. These bars blow away some of the best artisan expensive bars I’ve used like Caldwell Massey or Gentleman’s Nod or Ariana & Evans. These are now go to hand soap bars and I will use nothing else because these are so good. I don’t use liquid soap because I feel like I can never get it off and it feels like it’s always still stuck to my skin even after rinsing and rinsing and rinsing so I like using bar soap and I like bar soap that really dry out your skin for your hands and these little bars do it extremely well without over drying your skin. I do wish the scent was a bit more powerful because all 3 bars have a nice scent each. Tried the sandalwood bar in the shower and like I suspected go with the 6oz bars for the shower because these little 3.5oz guys just go too quickly for all over body use. So for the shower, I’ll use the 5.3/6oz bars and my hands these little guys will now be my go to!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
I
Verified Purchase
IAmSciAmoor
Battle Creek, US
★★★★★ 5
Great Quality Soap with a Clean, Masculine Scent
Size: 3.5 Ounce (Pack of 3), Size: 3.5 Ounce (Pack of 3)
I recently got the Rinse & Robust Men’s Bar Soap Set, and the bar I’m holding in the picture is the Leather scent, which my husband has been trying out first. It has a rich, masculine fragrance that smells clean without being too strong. The soap lathers nicely, rinses off easily, and leaves his skin feeling soft instead of dry. The set also includes Sandalwood and Teakwood, which both smell amazing in the box. I can already tell they’ll be just as refreshing. Each bar feels well-made and lasts longer than most store-bought soaps we’ve tried. The packaging looks great too, so it would make a thoughtful gift set. So far, the Leather scent has been a hit. It’s a classic, smooth, and perfect for everyday use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 31, 2025
C
Verified Purchase
Caleb
Natrona Heights, US
★★★★★ 4
My honest thoughts on this soap.
Size: 3.5 Ounce (Pack of 3)
I think this soap is very good. The texture is nice and the scent it omits is amazing. It is a little smaller than they are letting on and it is quite expensive. But if you like quality over quantity then this is for you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2026
S
Verified Purchase
Smilzcms
Cuba, US
★★★★★ 5
Great
Size: 3.5 Ounce (Pack of 3)
Bought for hubby as a gift. He loves all the different smells. Nice size for easy use. One bar seems to last a long time. Skin feels clean
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026

recommand products