SKU: 79039211996

INSR Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 20 - Aug 25

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

INSR ProteinProduct Specification Species Human Synonyms Insulin receptorINSR Accession P06213 1 Amino Acid Sequence V1005 K1310 VFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK Expression System Baculovirus

Product Specification


Species Human
Synonyms Insulin receptor,INSR
Accession P06213-1
Amino Acid Sequence

V1005-K1310

VFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK

Expression System Baculovirus-InsectCells
Molecular Weight 60467.0
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 20 mM Tris, 300 mM NaCl, 1 mM DTT, 10% glycerol, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 79039211996

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Acsa
Massapequa, US
★★★★★ 4
Good book
Format: Paperback
Delivered in good conditions and fast
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2021
J
Verified Purchase
Jacob Wells
Lexington, US
★★★★★ 5
Will help you to understand God's love and grace and the work of the holy spirit
Format: Hardcover, Format: Hardcover
This is a really great study bible especially if you are looking for a first time study bible it has lots of pages and is kind of heavy I used to be KJV only but have come to love the NKJV because its almost exactly like the KJV except it takes out the way they talked when KJV was releasedit doesnt include thee thou and words like sayeth instead has a lot of word you and better to understand. It is filled with God's love and grace and will help you to understand God's love and grace and also to study the bible. I got out of living a fear based relationship with God and living by works and having religious perfectionism this study bible has helped to reinforce the work of God's love and will help you if you read the bible and feel condemned or are struggling to understand. It's got great notes a big section rather than few which i didnt like that many study bibles dont have enough notes this has extra parts to help you to understand and also included prayers and has a good outline of yhe original text that is very well to read rather than making you feel overwhelmed. If you are looking for your first time study bible or are considering buying this I would reccomend it, don't be thrown off by the title of the study bible. Godbless.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2025
R
Verified Purchase
Richard Piatt
Chelsea, US
★★★★★ 5
I can't put this bible down!
What a perfect size. The font is totally readable and enhances the experience (way to go 2K/Denmark). The layout is an invitation to read: simple bible text with little to no distractions. References on the sides of the page are a great idea. All the references you might desire are there but they're out of the way - they don't interfere with your ability to pay attention to the bible text. The slightly cream toned white paper is sublime: wonderfully opaque and easy to page turn. The line matched text solves ghosting issues you've doubtlessly hated in previous bibles. I LOVE the red text (not words of Christ in red, this is a black letter edition) - it is the perfect artistic accent and it's functional as well. The red under gold art gilt page edging is so beautiful. It's a joy to open this bible up to see that red tone appear - a red tone matched to the red text (wow!). And even the three double sided silk ribbons (two black, one red) match the overall design of the bible. The goatskin is ... amazing ... this is my first goatskin bible and I'll not go back to any other type of leather again. It is nicely floppy on the first day. The bible feels like it is fully broken in on the first day you open it. The leather has a nice (naturally) pebbly texture but also feels somewhat smooth and is edge sewn for years of use. The edge gilt on the inside of the cover is beautifully done and perfectly frames the text block when the bible lies open - which it does flawlessly. The spine of the bible lacks raised dividers instead having printed dividers. They do the job nicely and the dual thin gold lines at each location is a very nice artistic touch adding to the overall presentation of the finished product. Simple text on the spine tastefully complete the overall design: HOLY BIBLE ... New King James Version ... Thomas Nelson. Nothing else is needed. Things that are somewhat unimportant to me but should be mentioned in case these matter to you: the bible maps are nicely done and the sizable concordance is impressive (albeit the font is a bit small). Note I'm in my 60's now and I've noticed many of my old bibles (old, dear friends) seem to have shrinking text recently. Ah, 60's ... oh joy. That is what drove me to seek out bibles with the 2K/Denmark fonts. This has been such a delightful surprise. The bible is a complete invitation to read. I read it daily and wish I had more time to devote to it. This is, to date, the best bible I've ever owned at any price point. I gladly give this bible my highest recommendation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 22, 2022
J
Verified Purchase
Jacques
Cuba, US
★★★★★ 5
Easy to read and full of exceptional knowledge.
What more is there to say. Nice Bible - like the leather smell. Easy to read and really like the soft binding - makes it easy to operate
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
B
Verified Purchase
Bradley
Houston, US
★★★★★ 5
Great Bible and Commentary
Format: Hardcover
Fantastic Bible and commentary. My friend bought this for me before I was saved, and it has been an amazing resource ever since. My understanding of Scripture has been helped significantly by this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026

recommand products