SKU: 82624162124

Human Angiotensin Converting Enzyme 1 Protein, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 23 - Aug 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Angiotensin Converting Enzyme 1 Protein, His tagProduct Specification Species Human Synonyms Angiotensin converting enzyme, ACE, Dipeptidyl carboxypeptidase I, Kininase II, CD143, DCP, DCP1 Accession P12821 Amino Acid Sequence Protein sequence (P12821, Pro631 Arg1232, with C His tag)

Product Specification


Species Human
Synonyms Angiotensin-converting enzyme, ACE, Dipeptidyl carboxypeptidase I, Kininase II, CD143, DCP, DCP1
Accession P12821
Amino Acid Sequence

Protein sequence (P12821, Pro631-Arg1232, with C-His tag) PLPDNYPEGIDLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSAR

Expression System HEK293
Molecular Weight Predicted MW: 71.1 kDa Observed MW: 95 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Angiotensin - converting enzyme (ACE) is a crucial enzyme in the body's renin - angiotensin - aldosterone system (RAAS). It plays a key role in regulating blood pressure and fluid balance. ACE is mainly found in the lungs, but is also present in other tissues. Functionally, ACE converts angiotensin I into angiotensin II, a powerful vasoconstrictor. Angiotensin II causes blood vessels to narrow, increasing peripheral resistance and thus raising blood pressure. Additionally, it stimulates the release of aldosterone from the adrenal glands, which promotes sodium and water reabsorption in the kidneys, further contributing to blood volume and pressure regulation. Dysregulation of ACE activity can lead to hypertension and other cardiovascular disorders, making it an important target for drugs like ACE inhibitors in treating such conditions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 82624162124

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mary
Fort Morgan, US
★★★★★ 5
Good aroma
Size: 3.5 Ounce (Pack of 3), Size: 3.5 Ounce (Pack of 3)
I bought this set of soaps out of curiosity and I was surprised. The three scents—leather, sandalwood, and teakwood—are warm and masculine without being heavy. They lather well, leave the skin clean and soft, and haven't dried me out like other men's soaps. The scrub has a nice texture, ideal for use after the gym, and the other two are gentler for daily use. The size is somewhat small, but each bar lasts quite a bit. Overall, a good option if you like to smell good and take care of your skin without complicating things.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 24, 2025
K
Verified Purchase
Kevin Crosby
Natrona Heights, US
★★★★★ 5
Natural soap
Size: 3.5 Ounce (Pack of 3)
Smaller than expected. Lathers well and smells great. Rinses off easily.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
M
Verified Purchase
Melissa
Carnegie, US
★★★★★ 5
Yummmm
Size: 3.5 Ounce (Pack of 6)
These smell absolutely amazing and leave my skin feeling great. They don't run out super fast and was a great gift for my husband
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
R
Verified Purchase
Richard Lockwood
Fort Morgan, US
★★★★★ 5
If you have sensitive skin and dont want premium prices, Cremo’s body wash is an excellent option A+
Scent: Palo Santo, Size: 16 Fl Oz (Pack of 1), Scent: Palo Santo, Size: 16 Fl Oz (Pack of 1)
Cremo’s body wash for men has become a staple in our household. The product exudes a luxurious feel, from the rich lather to the clean, long-lasting scent that genuinely resembles a more expensive fragrance. This body wash possesses a pleasant aroma of cardamom, papyrus, and most notably, palo santo. It features a warm, woody, and spicy scent, which is one of my preferred fragrance notes. Notably, the scent is strong without being overpowering. Additionally, I appreciate the aesthetic appeal of the bottle. The exquisite and vintage-inspired packaging complements the fragrance effectively. What truly sets Cremo’s body wash apart is its gentle nature. I have sensitive skin and this body wash does not cause dryness or irritation. In fact, it leaves my skin feeling soft and smooth, which is not always the case with other brands I have tried. The affordability of Cremo’s body wash is a significant advantage. It offers a high-end feel and fragrance without incurring excessive costs, making it an easy choice for repeat purchases. If you or your family have sensitive skin or simply desire a pleasant scent without paying premium prices, Cremo’s body wash is an excellent option. Highly Recommended. 5/5 Stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 5, 2025
J
Verified Purchase
Jorge Selman
Louisville, US
★★★★★ 5
If you want a great soap in a budget, buy Cremo body wash.
Scent: Cypress Santal, Size: 16 Fl Oz (Pack of 1)
Really good soap!! Leaves your skin soft and smells great. Light fragance and provides a good lather.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026

recommand products