SKU: 61686794171

AGER His Tag Protein, Mouse

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 20 - Aug 25

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

AGER His Tag Protein, MouseProduct Specification Species Mouse Synonyms RAGE Accession Q62151 Amino Acid Sequence Gly23 Ala342, with C terminal 8*His GQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALAGGGSHHHHHHHH

Product Specification


Species Mouse
Synonyms RAGE
Accession Q62151
Amino Acid Sequence

Gly23-Ala342, with C-terminal 8*His GQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALAGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 43-48kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Review Invest Clin . 2010 Jun;51(2):257-68.

Background

RAGE(Receptor for Advanced glycosylation End Products) is a 35kD transmembrane receptor of the immunoglobulin superfamily. It is also called AGER. Its name comes from its ability to bind advanced glycation endproducts (AGE), which include chiefly glycoproteins the glycans of which have been modified non-enzymatically through the Maillard reaction. RAGE represents an important factor in innate immunity against pathogens, but it also interacts with endogenous ligands, resulting in chronic inflammation. Studies have demonstrated the role of RAGE in inflammatory cell recruitment and leukocyte extravasation across the endothelial barrier.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 61686794171

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Snoopie
Los Angeles, US
★★★★★ 4
Cute but run BIG!
Size: 8 Toddler, Color: Macaroon
I can't get the jellies from Children's Place anymore. They are causing blisters. Wanted to try these but boy, they run HUGE. My daughters sneakers are Toddler sz 8. They are starting to get tight. So got a 9 in these. WAY big all around. So got an 8. Still, too big but will save those for next Summer. Would try a 7 but the price rose. Seem soft though and I like the brown color! Would recommend but sizing is difficult. Not just in length but all around they are bigger.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2025
S
Verified Purchase
SirTW
Bozeman, US
★★★★★ 5
Sleek, upscale and supremely comfortable
Size: 9, Color: Cognac
I did not know that Marc Joseph makes hands free slip ins. I own four pair of Skechers, and I thought they were the only game in town. I decided that I wanted a pair of business casual pair of wingtips. I already own two pair of Skechers Mark Nason wingtips in blue and black nubuck, so I bought a pair of their cognac colored. Perfectly fine shoes, but when they arrived, I didn't like the color, so the search was on! I found these cognac-colored Mark Joseph's and hands down, they fit the bill for what I was looking for! I actually bought two more pair of Skechers in the brown family in the same oxford, elastic lace style: One pair of another style of their Mark Nason line and one pair of their Garza line. So now I am comparing three pair of Skechers to the Marc Joseph's. Obsessive, I know :). Luckily, I have a Skechers store near me for easy returns. The look I was going for is a sleek, business casual that I could dress up or down. Three things that I love about the Marc Joseph's are the beautiful cognac finish: the white yet lower profile soles and the more formal, narrower toe style. The MJ's nailed it with the color. They have a slightly darker, more lustrous and glossier look than the others. The color alone looks classier and pairs well with black pants which I wear for work almost every day. The white soles are exactly what I was looking for. The visible rise is probably about a third of the thickness of the others and are a much more subtle, classier look. They offset the cognac color nicely but are not that in your face, sneaker looking, thick white sole. When I was comparing them to the others right out of the box, I thought they would be too narrow and tight because they looked sleeker and narrower than the others. But they fit perfectly and were very comfortable right out of the box. Upon closer inspection and comparison, I realized the narrower, sleeker look is because the eyelets for the elastic shoelaces are closer together that give the illusion that the shoe is narrower. They compensate for what might create a tighter fit across the top of your foot with two stretchy "gores" they are called on either side of the upper part. The "slits" are nicely finished, and you can't see the stretchy part and add a nice design touch to the shoe. But between them and the elastic shoelaces, they must stretch just enough to make them extremely comfortable across the top. So, if you have a high instep/arch, they should accommodate it nicely. Last but not least, they are very comfortable shoes. I wear a size 8 1/2 to 9 and my foot is slightly on the wide side. I bought the size 9's and they fit perfectly. If you are between sizes or have wider feet, you may want to size up a half size. Because the Skechers have much thicker soles, they might be slightly more cushioned, but the MJ's are cushioned more than enough for my purposes and very comfortable. Plus, they actually just feel better on my feet. I can't speak to how durable they will be as I just got them, but so far, so good. So, there you have it. I rely on other people's reviews a lot when buying online, and especially for shoes. I know it's always a crap shoot, particularly when buying shoes online, so I hope this review helps. Everybody's feet are different, but I highly recommend these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2025
S
Verified Purchase
Scott E.
Pawtucket, US
★★★★★ 5
Comfortable and stylish
Size: 12, Color: Black
I'm very pleased with these shoes. I rarely write reviews, but these are extremely comfortable and stylish. I bought a black pair and a brown paid. Many times I have to get a wide, but the standard size 12 fits me well. Easy to slip into, yet still snug while walking. I feel like the price is reasonable too. Good cushioning, not too thin of a sole.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2026
J
Verified Purchase
Jc
Carnegie, US
★★★★★ 4
Checkpoint
Size: 10.5 Wide, Color: Navy Grainy Leather
Good shoes, comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
J
Verified Purchase
jacqueline cosey
Houston, US
★★★★★ 5
Great buy
Size: 8.5 Wide, Color: Cognac
True to size. Love the style and feels amazing on your feet... Great item to buy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026

recommand products