SKU: 11577532710

Human Galectin-3, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 18 - Sep 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Galectin-3, His tagProduct Specification Species Human Synonyms 35 kDa lectin, Carbohydrate binding protein 35 (CBP 35), Galactose specific lectin 3, Galactoside binding protein (GALBP), IgE binding prtein, LGALS3, MAC2 Accession P17931 Amino Acid Sequence Protein sequence(P17931, Ala2 Ile250, with C 10*His)

Product Specification


Species Human
Synonyms 35 kDa lectin, Carbohydrate-binding protein 35 (CBP 35), Galactose-specific lectin 3, Galactoside-binding protein (GALBP), IgE-binding prtein, LGALS3, MAC2
Accession P17931
Amino Acid Sequence

Protein sequence(P17931, Ala2-Ile250, with C-10*His)
ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 27.8kDa Actual: 28kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 is a member of the lectin family, of which 14 mammalian galectins have been identified. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Galectin-3 (Gal-3) is also a member of the beta-galactoside-binding protein family that plays an important role in cell-cell adhesion, cell-matrix interactions, macrophage activation, angiogenesis, metastasis, apoptosis. Galectin-3 is increasingly being used as a diagnostic marker for different cancers. It can be screened for and used as a prognostic factor to predict the progression of the cancer. Galectin-3 has varying effects in different types of cancer. One approach to cancers with high galectin-3 expression is to inhibit galectin-3 to enhance treatment response.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 11577532710

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Ruckus
Carnegie, US
★★★★★ 4
Nothing Special
Works as intended. I bought it mostly for the Ethernet adapter which was plug and play with the latest installation of Fedora Linux and uses an AX88179 Gigabit Ethernet chipset. The Ethernet portion does not have activity lights. A bit of a lazy omission. Port locations are smartly placed with the HDMI output and power input at the back facing one direction, and the Type A USB peripheral ports facing the other. This is great for cable routing. The single Type C port is only for power delivery. It will not work for data to connect other peripherals.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
A
Verified Purchase
Ana Lucia Gonzalez
Alexandria, US
★★★★★ 5
UGREEN
Very useful and compact USB-C hub. It easily expands connectivity with HDMI, USB ports, and fast charging support. The 4K HDMI output works well for presentations and streaming, and the 100W power delivery keeps devices charged without issues. Build quality feels solid, and it’s perfect for travel or daily use. Great value for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
C
Verified Purchase
ChrisJE
Los Angeles, US
★★★★★ 5
Compact and useful.
It's small and light enough to fit in my bag easily. My computer uses a USB-c charger, and there's only one port, but I was able to use it for ethernet, and pass the charging through the same port. I've had issues with my computer not recognizing charging from some sources before, so this was great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
Y
Verified Purchase
Yolando G.
Natrona Heights, US
★★★★★ 5
Good choice
I like the design it looks sturdy. Te Number or ports is very useful
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
A
Verified Purchase
Aaron
Chelsea, US
★★★★★ 5
Great 10gbps USB-C Hub, worked with Anker support through compat issues with PD4 iteration 1
Original Review (updates below): ----- The moment I noticed this thing on Amazon, I bought it and it literally just arrived. Finally, 4K60 over just USB-C with other ports (including making up to 10Gbps available to them) for a reasonable price. Unfortunately, the first two things I've done with it were both disappointing. I'll cut to the chase, the power delivery pass through isn't working with one of their own chargers. The first device I tried connecting this with is my Anker PD4 with one USB-C cable as the only thing plugged into it so I can test the truly up to 100W (-15 for its own power) claims. I've tried connecting it with Apple's 2m USB-C charge cable (100w capable) and an equivalent CableMatters cable that also supports 100W. When plugged directly into my laptop, both of these cables immediately start charging it and show up as 100W power sources. When this Anker hub is plugged in and either of them is connected to the power delivery port on the side of it, the laptop does not charge (laptop is a 16" Macbook Pro, I've tried multiple ports just for the heck of it). My second complaint is that when absolutely nothing is plugged into it, it becomes fairly warm to the touch. Why, when it's doing nothing, is it hot? I'm clearly not running data or even power through it so I have low hopes for it under load. The fact that it doesn't work in exactly the scenario they want it to most (a MacBook Pro with one of their own chargers) seems like a pretty big fail. I've got lots of USB-C things though so I thought I'd grab a couple and try those. Using an Apple 96W USB-C charger, the device does pass through power delivery properly. It shows up as providing 79W to the laptop (siphoning off 17W in this instance). I also have a 56W Aukey charger that splits power between a USB-A port and a USB-C port that can provide 45W of power delivery. When plugged into that charger it does appear to work as well and appears in macOS as a 30W power source. Maybe the problem is the Anker PD4? But it works fine providing power to the laptop directly. Would love to hear from Anker about these two products working together and what I should actually expect. Having it be unreliable for power delivery isn't great, but power and heat aside (it is getting a little bit warmer now that it's providing power from the Apple power adapter, but still definitely holdable), the hardware looks and feels good and the cable feels durable. Worth also noting that there's a white LED ring on the side of it that appears to be always on when it's plugged in. Don't know why it needs an LED. ----- Update, June 22, 2020: I've done some more testing and Anker has reached out to me to investigate what might be the issue. I can say that the hub works as I would expect from a quick test with my iPad Pro 11" with the above functioning chargers. It was able to pass through power with the 96W Apple Charger on the other end to both the iPad port as well as a Magic Keyboard port. The ethernet adapter showed up in iOS settings and an external drive was functional. When connected via the Magic Keyboard, which is a power only connection, as expected it provided only power. Still no power passthrough of any kind when connected to the PD4. ----- Update July 1, 2020: I've written back and forth with Anker and they've sent me a replacement hub. It also doesn't work with the PD4. I've tried multiple USB-C cables but they have also shipped a cable to test with it. For now I'm increasing the review from 2 to 3 stars because I am more and more suspicious about the PD4 and less about this hub. They claim that they have tested the setup I have separately without issue, and I've sent video showing the problems I've encountered, so the troubleshooting is ongoing. Have had a chance to use Ethernet on it without issue. Still need to try to test out its throughput when trying to use a 10Gbps USB-C enclosure and a 4K60 monitor at the same time (+ ethernet). More updates to come. ----- Update July 10, 2020: I've continued to talk with Anker support and they shipped me a replacement PD4. The one I had was labeled as "Iteration 1" on its barcode, the one I got back was labeled "Iteration 2". I tested it out and it works perfectly with this hub, passing through the correct amount of power to multiple Macbook Pros and fast charging an iPad Pro. Clearly the fault doesn't lie with this hub and is instead an issue with the first iteration PD4, so I'm updating my review accordingly. Working with Anker support was great. I've also been able to test USB-C throughput (without driving a display as well so far) and it properly utilizes 10Gbps. I've attached some extra images showing various devices connected to it (keyboard dongle, SD card, USB-C 10Gbps external SSD enclosure, USB sound card, ethernet).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 19, 2020

recommand products