SKU: 13834122973

IL-31 Protein, Canine

Sale price$152.10 Regular price$169.00
Save 10%

Pay in installments of $42.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-31 Protein, CanineProduct Specification Species Canine Synonyms IL 31,IL31,Interleukin 31 Accession C7G0W1 Amino Acid Sequence Ser24 Gln159 with C terminal 8*His MSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQHHHHHHHH Expression System E. coli Molecular Weight 17kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Canine
Synonyms IL-31,IL31,Interleukin-31
Accession C7G0W1
Amino Acid Sequence

Ser24-Gln159 with C terminal 8*His

MSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQHHHHHHHH

Expression System E.coli
Molecular Weight 17kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4, 5% Trehalose.
Reconstitution econstitute at 0.1-0.5mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. J Allergy Clin Immunol. 2023 Jul 13;S0091-6749(23)00888-6. Online ahead of print.
2. Allergy. 2023 Jul 13. Online ahead of print.
3. Clin Exp Med. 2023 Jul 1. Online ahead of print.

Background

IL-31 which produced by activated Th2-type T cells. IL-31 signals through a receptor composed of IL-31 receptor A and oncostatin M receptor. IL-31 activates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR. IL-31 has also been identified as a major player in a number of chronic inflammatory diseases, including atopic dermatitis. Patients with atopic dermatitis, chronic spontaneous urticaria, allergic contact dermatitis, prurigo nodularis, primary cutaneous lymphoma and mastocytosis exhibit increased serum levels of IL-31 protein and elevated IL-31 mRNA in the skin.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13834122973

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Customer
Natrona Heights, US
★★★★★ 5
Great Product
Color: Matte White, Style: 3000K Warm White LED
Just had them installed. So far, really like them. Displaces a lot of air, are not noisy, and are pleasing to look at.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 16, 2024
N
Verified Purchase
Net Paper
Whiting, US
★★★★★ 4
Great fan, quite, powerful
Color: Brushed Aluminum, Style: No Light Kit
Initially got bad receiver, after contracting customer service new one was shipped next day, after replacing it worked like a charm, no issues connecting to wifi
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2023
A
Verified Purchase
Al
Battle Creek, US
★★★★★ 5
Smooth Operation
Color: Brushed Aluminum, Style: No Light Kit
This Fan has exceptional airflow and operates smoothly. I use the included remote control. It took a little white to install and it’s fairly heavy, but besides that, it’s great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2022
C
Verified Purchase
chrissycf
Grantham, US
★★★★★ 5
Absolutely the best in the series so far!
Format: Kindle
I've been wanting to get Dean's book since we met him in The Deal, and let me tell you, this book did NOT disappoint! Dean is the playboy of the hockey team, he doesn't do relationships, and he just takes life as it goes. Allie is Hannah's best friend and roommate, and is a relationship type of girl. When she realizes her and her boyfriend are moving in separate directions and she can't do it anymore she breaks up with him. When she needs a place to hide out, Garrett offers up his house while they are away. She never expected that weekend to change everything for her. Dean and Allie definitely have amazing chemistry, but one night together doesn't change things for them, or does it? Dean can't get Allie out of his head, and Allie knows she can't do a casual hookup, but they can't seem to keep away from one another. I loved how Dean finally wore Allie down, and how Allie finally got to have someone with her that understood her and was just as adventurous as she was. I don't agree with how she didn't want anyone to know about them, but I think the way everyone found out was perfect for them. Dean and Allie's "relationship" is full of emotions, and you can slowly see this turning into something way more than what they thought it would be. Dean is amazing with Allie, he's supportive of her, he cares about her, and he's insanely jealous of anyone who dares look at her. Allie is loving how Dean makes her feel, and is also a huge supporter of his. For once in his life Dean opens up about himself and you can tell how nervous he was telling her about his ex, and everything involving the fall out of that situation. Their escapades are hilarious and sexy all at once. I loved watching them during Thanksgiving with Beau and his sister, where you can see that things definitely changed for them. I also adored their watching of the french soap opera, and all the little things they did together. Not only does this book have a true romance that you can't help but fall in love with these amazing characters, but there are some absolute laugh out loud moments. When Logan walks in on Dean and "Winston" I spit my drink out I was laughing so hard. Also the hilarious Twilight references on imprinting! There is also a very serious aspect to this book that had me in tears. My emotions were definitely all over the place while reading this book, and I must say I think I love Dean more than Garrett, and he's been sitting at the top of my BBF list for a long time! It's been a long time since I've read a book that I absolutely loved both of the main characters. I felt so connected to them, and their group of friends, that I thought I was right there with them experiencing their love, their laughs, and their heartbreak. This book definitely took me on one hell of a ride. I can't remember laughing so hard one moment, swooning and falling in love, and then balling my eyes out, only to have my heart put back together at the end. This is a beautifully written story and I could NOT put it down. I am definitely looking forward to Tuck's book, especially with the bomb-shell he dropped at the end of Dean's story! Even though this book can be read as a stand-alone, I highly suggest reading each of the previous two books in this series, so you can get a good feel of how much Dean has changed since we met him, as well as how the group dynamic works. Each one of the books are 5 star reads, and trust me, you will definitely fall in love with Garrett, Logan and Dean!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2016
I
Verified Purchase
Ivy D.
Carnegie, US
★★★★★ 4
The Good, The Bad and Everything In Between
Format: Kindle
Another excellent entry: The Off-Campus series is among the very, very best in new adult romance and there is little that isn’t done well in this entry. Dean DiLaurentis is charged with watching out for Allie, Hannah’s roomie, one weekend while everyone is gone for various reasons - with, of course, the obligatory threats to his penis if he were to touch Allie. She’s just gone through a painful breakup with her boyfriend from book one, since they’ve had a fairly tempestuous relationship, she needs some time away from her apartment, where he’s been trying to get her to change her mind. Of course, Allie and Dean are young, hot, single and there’s tequila. When you do the math, it’s fairly obvious that yes, Slot A goes into Tab B, and yes, romance happens. I love their banter, the humor throughout really establishes these characters and their friendships and makes the ride all the more enjoyable. Speaking of riding... Dean’s what I expected: Dean’s the manho who beats all the previous manhoes in this series. He makes no apologies and I loved that he didn’t. He’s intrigued with Allie but he isn’t in love from the moment he lays eyes on her. When he falls, though it’s hard and it’s clearly life-altering. His moments with his friend Beau when they discuss his issues with little Dean (I can’t stop giggling at that silliness) were priceless. He has a good journey towards adulthood, though I was saddened by the events that led to this character growth. It was the perfect (sad yet realistic) touch of bitter to make the sweet all the richer. Allie was a surprise: I’ll admit, this is mostly because I didn’t remember her. Allie isn’t a big part of the first book and what I did remember of her was a bit flaky. I loved getting to know her and seeing what made her tick and as with Ms. Kennedy’s previous heroines, there is more than meets the eye. She’s concerned about being slut-shamed by the prospect of no-strings sex, considering she’s only ever been in committed, long term relationships, so I love that she has to learn to accept that there’s nothing wrong with two consenting adults doing what they want to do, damn public opinion. I found it an interesting twist that the only person truly slut-shamed is Dean, by other men and women. Beats played out as I expected: If I have any issues with this is, while it is entertaining, charming, and funny, it also felt the same as the earlier books, which were also entertaining, charming and funny. When the quality is so high, that’s not a horrible thing, but I can’t help but struggle to keep each set of heroes and heroines separate in my mind. That said... I’m really intrigued by where this series is going next: The setup for the next book is markedly different and it has me really eager to see how Ms. Kennedy handles it. The heroine for the next book is NOT in the mold of the earlier women and the hero is a bit of a wild card, since he has been more on the periphery so far. I’m looking forward to seeing what they have to contribute to this universe. The Bottom Line This is an excellent new adult romance with likeable characters, funny banter, hot sex scenes and room for the ‘verse to grow. If you haven’t read Ms. Kennedy’s series, I highly recommend it. **ARC provided by author for review**
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2016

recommand products