SKU: 1529982199

TMIGD2/CD28H Fc Chimera Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TMIGD2/CD28H Fc Chimera Protein, HumanProduct Specification Species Human Accession Q96BF3 Amino Acid Sequence Leu23 Gly150, with C terminal Human IgG1 Fc

Product Specification


Species Human
Accession Q96BF3
Amino Acid Sequence

Leu23-Gly150, with C-terminal Human IgG1 Fc LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 49-64kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Transmembrane and immunoglobulin domain containing 2 (TMIGD2)is new a immune checkpoint molecule of the B7:CD28 family which is a novel cell adhesion receptor that is expressed in various human organs and tissues, mainly in cells with epithelium and endothelium origins. TMIGD2 regulates cellular morphology, homophilic cell aggregation, and cell-cell interaction. TMIGD2 activity also modulates actin stress fiber formation and focal adhesion and reduces cell migration. Silencing of expression of TMIGD2 by small interfering RNA (siRNA) and by ectopic overexpression in endothelial cells showed that TMIGD2 regulates capillary tube formation in vitro, and B16F melanoma cells engineered to express TMIGD2 displayed extensive angiogenesis in the mouse Matrigel angiogenesis model. Moreover, TMIGD2, through its proline-rich cytoplasmic domain, associates with multiple Src homology 3 (SH3)-containing signaling proteins, including SH3 protein interacting with Nck (SPIN90/WISH), bullous pemphigoid antigen-1, and calcium channel β2.Silencing of expression of SPIN90/WISH by siRNA in endothelial cells showed that SPIN90/WISH is required for capillary tube formation. These features of TMIGD2 suggest that TMIGD2 is a novel receptor that plays an important role in cell-cell interaction, cell migration, and angiogenesis. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1529982199

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
MR
Houston, US
★★★★★ 5
First you must believe in yourself
Format: Kindle
This is not just a love story but of understanding that when you believe in yourself, good things will come your way. Keeping an open mind and finding you can love things you never dreamed of.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 29, 2024
K
Verified Purchase
Katlynn Shult
Draper, US
★★★★★ 5
grumpy lesbian meets optimistic bisexual
Format: Kindle
Fun easy read about a mish mash family coming together to help each other save the farm they became a family on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 24, 2024
L
lololovesfilms
Louisville, US
★★★★★ 4
There are some issues, but overall, this is a good book!
Format: Paperback
3.5 stars. I have always enjoyed Jennifer Dugan's writing, so I was excited to read "The Ride of Her Life." This is a sapphic fish-out-of-water, angst-ridden romance between two polar opposite protagonists thrust together after tragedy strikes. Molly has just inherited a commercial horse barn from her estranged aunt (her mom's sister). It is the best thing that has happened to her in a while, and while she's sad about her aunt's passing, she sees this inheritance as a huge life change and a way to make her dreams a reality. Shani is the farrier who lives on the compound. She also helped take care of Molly's aunt in the last days of her life. Shani thought *she* was going to inherit the barn from Molly's aunt, especially since she worked there for years and is full of experience when it comes to running the place. The longer Molly stays at the property, the more she connects to the area, the animals, and the people her aunt loved, cared for, employed, and valued. At constant odds with one another, Molly and Shani are essentially rivals and enemies. Shani doesn't want Molly to sell the property, but Molly needs to pay off her student loans and get her business off the ground. Will they eventually see eye to eye? What you will find in this book is a relatively quick, fun read that is offset by its heavier themes. Unlike "Love at First Set," the balance between seriousness and levity didn't quite mesh as well for me. I liked the enemies-to-lovers vibes in this book, that aspect is handled really well! This leads to a lot of pining and tension between Molly and Shani early on, which sets the stage for some epic steaminess in the latter portion of the book. Unfortunately, what you will *also* find here is a *metric ton* of miscommunication, so if you're not into that trope, stay away from this book. I also wish I had known more about Shani. Her exposition and backstory feel very scant compared to Molly's. We know she has a lot of trauma from when she was younger, but that's about it. Nothing is expounded upon too tremendously. Another thing that stood out to me is how it is repeatedly mentioned that Molly has made it a habit of getting lost in her past relationships. Molly falls fast and jumps in head-first. There's no real indication that her dalliance/tryst/potential relationship with Shani is any different just because they shared some deep confessional moments. Molly's still just turning herself into a horse girl to satisfy Shani's career even though she loves everything antithetical to that lifestyle because..... love? S3x? Both? Finally, while I am satisfied with the ending where the two protagonists are concerned, it feels like there is little resolution between Molly and her best friend Nat, and between Molly and her mother. Still, there is a lot to like about this novel!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2024
D
Verified Purchase
Daniel Z.
Carnegie, US
★★★★★ 5
Anthony Bourdain comic book extravaganza
Format: Paperback
My friend loved it. A nice gift for anyone who loves to cook
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025
R
Verified Purchase
Rui Miguel Silveira
Belleville, US
★★★★★ 5
Exceptional
Format: Kindle
Anthony Bourdain would not reject this story of a monster so in love with what is better in our human nature. This is indeed a master piece because it is so well crafted and therefore so mooving. A delicious journey through deep feelings, food, love, generosity... and hunger for Life!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2025

recommand products