SKU: 2052608965

Human PAPP-A, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 19 - Sep 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PAPP-A, His TagProduct Specification Species Human Synonyms Pappalysin 1, Insulin like growth factor dependent IGF binding protein 4 protease (IGF dependent IGFBP 4 protease; IGFBP 4ase) Accession Q13219 Amino Acid Sequence Protein sequence(Q13219, Pro1200 Gly1627, with C 10*His)

Product Specification


Species Human
Synonyms Pappalysin-1, Insulin-like growth factor-dependent IGF-binding protein 4 protease (IGF-dependent IGFBP-4 protease; IGFBP-4ase)
Accession Q13219
Amino Acid Sequence

Protein sequence(Q13219, Pro1200-Gly1627, with C-10*His)


PAEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQTGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 48.8kDa Actual: 65kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Pappalysin-1, also known as pregnancy-associated plasma protein A, and insulin-like growth factor binding protein-4 protease is a protein encoded by the PAPPA gene in humans. PAPPA is a secreted protease whose main substrate is insulin-like growth factor binding proteins. Pappalysin-1 is also used in screening tests for Down syndrome.PAPPA's proteolytic function is activated upon collagen binding. It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses (fetuses with an abnormal number of chromosomes).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2052608965

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Verified Purchase
Wayne
Cuba, US
★★★★★ 5
Excellent pillows
Size: Queen - 20"*30" (pack of 2), Color: Grey
Very nice pillows seem well made perfect size after a couple of days the filling is absolutely perfect provides plenty of support
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
T
Verified Purchase
Tracey Anderson
Pawtucket, US
★★★★★ 5
Great pillows at a great price.
Size: Queen - Pack of 2, Style: Soft, Configuration: Pillow
I ordered these to go in decorative pillow cases. The price was right. They are surprisingly comfortable, though--may just become my new go-to pillows! Not too soft...not too firm...juuuust right...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
K
Verified Purchase
K. Gerber
Belleville, US
★★★★★ 5
Great pillows!
Size: Queen - Pack of 2, Style: Soft, Configuration: Pillow
Great two pack of pillows! Reasonably priced and very good pillows! A choice of firmness depending on how one sleeps - side, tummy,back - great! Who wouldn't want some fresh new pillows?☺️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
L
Verified Purchase
LaTally Puckett
Pawtucket, US
★★★★★ 5
Excellent pillows
Size: Queen - Pack of 2, Style: Soft, Configuration: Pillow
One of the best and pillows I have ever slept on. They were incredibly soft but still incredibly supportive. The quality of the pillows were comparable to hotel pillows. I will be ordering again and I am very satisfied with my purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
S
Verified Purchase
Susan
Lake Worth, US
★★★★★ 4
Fat pillows
Size: Queen - Pack of 2, Style: Soft, Configuration: Pillow
Super overstuffed pillows. Took some of the batting out, and it was more comfortable. I would buy them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026

recommand products