SKU: 29727601083

Human PTH, His tag

Sale price$31.50 Regular price$35.00
Save 10%

Pay in installments of $8.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 19 - Sep 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PTH, His tagProduct Specification Species Human Synonyms parathormone; Parathyrin Accession P01270 Amino Acid Sequence Protein sequence(P01270, Ser32 Gln115, with C 10*His) MSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 11. 2kDa Actual: 10 11kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms parathormone; Parathyrin
Accession P01270
Amino Acid Sequence

Protein sequence(P01270, Ser32-Gln115, with C-10*His)
MSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 11.2kDa Actual: 10-11kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Parathyroid hormone (PTH) is secreted by the parathyroid glands as a polypeptide containing 84 amino acids. PTH acts to increase the concentration of calcium in the blood by stimulating at least three processes: mobilization of calcium from bone, enhancing absorption of calcium from the small intestine, suppression of calcium loss in urine.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29727601083

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
L. Ramsey
Carnegie, US
★★★★★ 3
I thought these are Cute My dogs didn't think so
These are cute and would work well for medium and larger dogs.  Not dogs under 25lbs.  The toys are to big for their little mouths and they can't get a hold of them to play with them.  
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 11, 2025
D
Verified Purchase
Darcie
Carnegie, US
★★★★★ 5
Fun little ball!
Fun little ball! Glad I got the football version the regular ball would be a choking hazard for my Great Dane. The ball rolls and shakes on the floor which at first was scary, but now she loves it! She nudges it all over the floor to keep it moving, keeping her entertained for a bit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
R
Verified Purchase
Rodolfo Israel Barranco Rivera
Belleville, US
★★★★★ 1
Won't hold charge
Unfortunately the toy would not hold charge. I charged it for couple hours and it wouldn't turn on. I tired a different charger to be safe and still nothing. Was hoping to share this exciting toy with my pup, guess I'll keep looking for alternative.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 20, 2025
A
Verified Purchase
Amazon Customer
Belleville, US
★★★★★ 5
Luxury Dog, Luxury Toy”
“ I previously tried another toy, but its outer layer peeled off easily and even caused issues .This ball, however, is different. Even though my little dog chews on it, the ball recovers easily and causes no damage. It even gives a gentle workout for my pup’s gums and teeth. Maybe because my dog is small, it seems to restore well and is a perfect fit! At first, I saw this advertised mostly for larger dogs. However, even though my pup is really small, they have no trouble playing with it and enjoy it just as much!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
M
Verified Purchase
Maryjcm1
West Palm Beach, US
★★★★★ 3
Dog loves it; but some poor construction
My small dog instantly loved this toy! I like the squeaker, bounciness, and options for different kinds of movement in the interactive play. It also recharges fast. However, I have two downsides: While my dog isn’t a big chewer, he got through this in a couple weeks. So we are on our second shell. That’s a nice option to be able to order just the shell. Second, both shells have the same issue: they won’t stay screwed shut. The second shell is worse at this than the first. Once unscrewed, the interactive/mechanism piece will fall out and chocks be a choking hazard. It also frustrates my dog and he just barks at it until I fix it. With the new shell I think I had to fix it 5 times in the first 10 minutes of play. Overall, it’s a fun toy and we’ll keep playing on!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 24, 2025

recommand products