SKU: 2354204701

Human IL-8, His Tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 19 - Sep 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-8, His TagProduct Specification Species Human Accession P10145 Amino Acid Sequence SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 10. 1 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 0. 2M PBS, pH7. 4 Reconstitution Reconstitute at less than 1 mg mL according to the size in deionized water

Product Specification


Species Human
Accession P10145
Amino Acid Sequence

SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight

10.1 kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Background

IL-8, also known as chemokine CXCL8, is a cytokine secreted by macrophages and epithelial cells. IL-8 binds to interleukin-8 receptor α(IL8RA, also called CXCR1) and interleukin-8 receptor β(IL8RB, also known as CXCR2), resulting in cytochemotaxis neutrophils to regulate inflammatory responses. IL-8 also has a strong pro-angiogenesis effect.IL-8 is almost undetectable under physiological conditions, but under inflammatory conditions, IL-8 levels are rapidly increased by TNF-α, IL-1β and other effects. IL-8 binds to CXCR1 and CXCR2 to promote tumor growth, progression, metastasis and drug resistance through a series of mechanisms. IL-8 plays an important role in the pathogenesis of bronchitis and cystic fibrosis. This product is the recombinant human IL-8 protein expressed from human 293 cells (HEK293).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2354204701

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Akino
Whiting, US
★★★★★ 4
Great Suit, Fits Good and Very Comfy
Color: Navy, Size: 44, Color: Navy, Size: 44
I bought the MOGU Suit 2 piece slim fit suit kinda last minute for an event, and honestly I was suprised by how good it came out. The quality is better than I expected for the price. The fabric feels smooth and not cheap or itchy. The fit was pretty good overall. The jacket sits nice on the shoulders and the sleeves lenght was just a little bit longer than I like, but not a big deal. The pants fit slim but not tight, so I could move around without feeling uncomfortable. I think the sizing is mostly true, but if you're between sizes go up one. The stitching was actually clean and neat. I checked the seams because I’ve had suits before where threads be sticking out everywhere, but this one was solid. No loose ends, no weird cuts. Comfort wise, it’s suprisinly good. I wore it for hours and it didn’t feel heavy or rough. The one-button blazer gives it a nice modern look too. Overall, good buy for the money. Not a high-end designer suit, but for the price range it’s really good and looks way more expensive than it is. I’d definetly order again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2025
A
Verified Purchase
Amazon Customer
Phoenix, US
★★★★★ 5
Nice suit
Color: White, Size: 32
Nice suit, too small for my teenager
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2026
T
Verified Purchase
Thuhuong N.
Omaha, US
★★★★★ 5
Comfortable
Color: Black, Size: 30
My son love the fits and colors. Great quality and the very little stretchiness. No wrinkles at all . Feel very comfortable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
C
Verified Purchase
CJ Demas
Louisville, US
★★★★★ 1
Just basted together
Color: Orange, Size: 30, Color: Orange, Size: 30
At first, I was super excited and thought it was a fantastic deal. I bought this suit for a work event, and got it a few days early. I tried it on, everything fit well, I loved the fabric, nothing was tight at all but neither was it loose. Then, I wear it to work. I even took a picture before heading off to work, where everything was still perfectly out together and no issues were visible. And then I sit down at work to eat my breakfast, and notice that stitching RIGHT OVER MY CROTCH had come loose and made a hole. Not popped, the stitching was not broken or anything, but just unraveled. Nothing was tight, and sitting down and walking felt normal so I know I didn’t strain the fabric at all. The stitches were just loose, and the thread was all over the place. Luckily I don’t think anyone saw, I was able to keep my legs crossed or cover the problem area strategically with my water jug or bag. But my house is an hour’s drive away from my work, so I couldn’t just go back and change. I had to borrow a stapler and STAPLE THE HOLE SHUT. Yes, lesson learned, I bought several emergency sewing kits that I will stuff in everything I carry with me everywhere in case something like this happens again, but still. It was BRAND NEW. Not only that, but as I was in the restroom stapling my new suit pants back together, I found the issue. The crotch area was just basted together, no backstitch or proper finishing at all. And it continues down the leg, I had to be careful not to bend my legs too much or those seams would also unravel. They already loosened a little bit and risked showing my skin underneath just by walking. I managed to play it off and keep my body posed in such a way that it was unnoticeable, especially with help of the staples, but still! Super embarrassing, especially since I’m in a large training class right now and everyone found out just because I had to ask everyone if they had a sewing kit on them. I was so ready to chock this up as a win, too. Good thing I postponed my review. Sloppy sewing all around really, once I took a moment after getting home to look closer. Some areas are sewn well and finished properly, but others are still only basted shut or the end of the thread wasn’t anchored at all. I’m going to spend a lot of time re-doing the stitches, because I’m too stubborn to send the piece back and I know how to sew better than whatever machine made this anyway so I don’t wanna waste the fabric. Such a disappointment.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2024
D
Verified Purchase
David M Johnson
Battle Creek, US
★★★★★ 5
I can’t believe the quality for the money
Color: Hot Pink, Size: 38
I am a suit designer for a better priced menswear brand. I bought this suit for a “day-glo” party, so the expectation was going to be one wearing to a party. I wasn’t expecting much for the money, but the color filled the bill. When I received it, I couldn’t believe how great the construction and quality were. The jacket is fully lined, contrast interior piping, interior double welt pockets on both sides, and the fit was really exceptional. The pant had fully taped interior seams, pick stitched curtained waistband, split back seam (so you can easily gave it altered if you need), interior front closure button and tab, hook and eye and exterior button. Note: no one mentioned this, but the waistband is discretely adjustable like a rental tux, so enables fit for a wider range of sizes. The jacket runs true to size, but the pants have some flexibility and are easily altered, so buy your jacket size… that would be harder to alter. The only gripe is the buttons are super cheap looking, and white colored (surprised they weren’t dyed to match, given the rest of the quality).. I’ll be changing them out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 14, 2023

recommand products