SKU: 24810629210

Human FDX1 Protein, His Tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 12 - Sep 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FDX1 Protein, His TagProduct Specification Species Human Synonyms Adrenodoxin, mitochondrial, Adrenal ferredoxin, Ferredoxin 1, Hepatoredoxin, ADX Accession P10109 Amino Acid Sequence Protein sequence (P10109, Ser61 Ser184, with C His Tag) SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS Expression System E. coli Molecular Weight Predicted MW: 15. 4 kDa Observed MW: 13 kDa Purity 90% by SDS PAGE

Product Specification


Species Human
Synonyms Adrenodoxin, mitochondrial, Adrenal ferredoxin, Ferredoxin-1, Hepatoredoxin, ADX
Accession P10109
Amino Acid Sequence

Protein sequence (P10109, Ser61-Ser184, with C-His Tag) SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

Expression System E.coli
Molecular Weight Predicted MW: 15.4 kDa Observed MW: 13 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

FDX1, or ferredoxin 1, is an essential mitochondrial iron-sulfur protein that functions as a critical electron carrier in several fundamental biochemical pathways. Primarily located in the mitochondrial matrix, it shuttles electrons from NADPH via ferredoxin reductase to key enzymes involved in steroidogenesis, heme biosynthesis, and iron-sulfur cluster biogenesis. By facilitating these electron transfer reactions, FDX1 plays a central role in cellular metabolism, energy production, and the synthesis of vital biomolecules. Recent research has also highlighted its significant role in regulating copper-dependent cell death (cuproptosis), making it a protein of growing interest in cancer biology and therapeutic development.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24810629210

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Benjamin Nagy
Lake Worth, US
★★★★★ 5
Every new parent and grandparent should read this book.
Format: Paperback
Exceptionally practical book for every new parent and grandparent
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
T
Verified Purchase
Theresa
Boise, US
★★★★★ 4
Ignore the sales pitch and absorb the advice
Format: Paperback
I agree with other reviews, great advice but the dr really pushes his products in it. I guess the guys gotta make some money. Worth the read though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 5, 2025
E
Verified Purchase
Eric
Natrona Heights, US
★★★★★ 5
Nuggets of knowledge
Format: Paperback
This book has a lot of knowledge you may already know and/or would definitely see anywhere else on the internet. I found this to be an easy read that I briefly scan over until I find what I’m more curious about. There are several parts we found to be helpful and just good to have. It’s like adding more “tools”(skills) to the tool chest. As a new parent, I’m always trying to be a learner. We learned from the little nuggets of knowledge inside these pages It’s a very affordable book that you can buy used for just a few bucks. Low risk, high reward. Best of luck to all the new parents out there and congrats to your growing families. 🤙
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 29, 2023
J
Verified Purchase
Joan Rabot
Los Angeles, US
★★★★★ 5
The Happiest Baby on the Block Book
Format: Paperback
Great baby shower gift
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2026
R
Verified Purchase
Rob T
Birmingham, US
★★★★★ 3
Great lessons, very repetitive content
Format: Paperback
Not that I am hoping my baby will be a screamer, but if he is I hope that the lessons learned from this book will be put to good use. It’s a decent read in terms of learning actual techniques - hence the five stars - however its length is equivalent to being given a 2,000 word assignment and you reiterate the same five things four times in different ways. I would recommend buying the video on Amazon Video for like $5 to see how the man actually puts these techniques to practice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026

recommand products