SKU: 2891188935

Human IgG2 Fc

Sale price$40.50 Regular price$45.00
Save 10%

Pay in installments of $11.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 13 - Sep 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IgG2 FcProduct Specification Species Human Synonyms Ig gamma 2 chain C region, Ig gamma 2 chain C region DOT, Ig gamma 2 chain C region TIL, Ig gamma 2 chain C region ZIE Accession P01859 Amino Acid Sequence Protein sequence(P01859, Glu99 Lys326(V161M, S257A), no tag)

Product Specification


Species Human
Synonyms Ig gamma-2 chain C region, Ig gamma-2 chain C region DOT, Ig gamma-2 chain C region TIL, Ig gamma-2 chain C region ZIE
Accession P01859
Amino Acid Sequence

Protein sequence(P01859, Glu99-Lys326(V161M, S257A), no tag) ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGMEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Theoretical:25.7kDa Actual:30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag N/A
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The fragment crystallizable region (Fc region) is the tail region of an antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system. This property allows antibodies to activate the immune system. Fc binds to various cell receptors and complement proteins. In this way, it mediates different physiological effects of antibodies (detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2891188935

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
terrydodson
Battle Creek, US
★★★★★ 5
For the price it’s a really good yoga Matt
Color: Blue, Style: 1/2 Inch
For the price it’s not bad. I use for multiple things, not just yoga, it’s nice and thick I used it to lay on the floor and fix my table and gaming chair and to get under hard to reach places when I don’t want lay directly on the floor. it’s soft enough not to hurt my back very well put together strong material.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
D
Verified Purchase
Danny B.
Grantham, US
★★★★★ 5
This is a nice mat for floor exercises.
Color: Aqua, Style: 1-Inch
I had some lower back issues and went to physical therapy. I used this mat for my floor stretches and exercises at home along with my big rubber ball. It made the floor work so much more comfortable. Beware of the smell. When I unroll it I still smell that “memory foam” odor, which takes some getting used to. I aired it out as instructed, twice, and it persists. It’s a wonderful mat so the odor is not a deal breaker. I’d buy it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
K
Verified Purchase
Karla Lara
Los Angeles, US
★★★★★ 5
Maximum joint comfort and durability
Color: Pink, Style: 1/2 Inch
I absolutely loved the color, and it offers incredible cushioning without sacrificing stability during balance poses. It is dense, doesn't lose its shape, and springs back instantly. The materials are high-quality, and it doesn't have that strong plastic smell that others often have. It is worth every penny for the comfort it provides.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
D
Verified Purchase
Dr. Manetta
Waukegan, US
★★★★★ 5
These sunglasses are such a great combination of style, comfort, and value.
Color: Going to Valhalla...witness\!, Color: Going to Valhalla...witness\!
I absolutely love these sunglasses. They’re lightweight, comfortable, and fit perfectly without constantly sliding down your face. The medium-sized frame is super flattering and works well for both workouts and everyday wear, which honestly makes them one of the most versatile pairs I own. The polarized lenses do a great job cutting glare, especially for driving, beach days, walks, and outdoor activities, and I appreciate that they still feel stylish instead of overly sporty. The quality is impressive for the price point, and they’re durable enough that I don’t panic about bringing them on trips, hikes, boat days, or throwing them in my bag. They’ve definitely become my go-to sunglasses for everything from walking the dog to vacations to casual everyday errands. Cute, functional, affordable, and surprisingly high quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
K
Verified Purchase
kate
Natrona Heights, US
★★★★★ 5
Impressed! Perfect for summer
Color: Phoenix at a Bloody Mary Bar V3
These sunglasses are spectacular, i am very impressed for the price point. Affordable, good quality, lightweight, and fit perfectly! I have very sensitive eyes, so I have to be very picky about the sunglasses I wear, usually having to spend $$ for a good pair. These pass the test, at a fraction of the cost. The lenses are polarized and block the sun fairly well. Wore these on a walk as soon as I bought them, and I am already wanting to buy another pair!! definitely recommend, if you are looking for something that is sleek, but fun. Can also be a great gift!! Love the variety of color options!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026

recommand products