Pay in installments of $90.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 8 - Sep 13
For Your Every Summer RSVP, with Code: SUMMER15
Description
LILRA1 His Tag Protein, HumanProduct Specification Species Human Accession O75019 1 Amino Acid Sequence Pro17 Asn461, with C terminal 8*His
Product Specification
| Species | Human |
| Accession | O75019-1 |
| Amino Acid Sequence | Pro17-Asn461, with C-terminal 8*His PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 72-85 kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Leukocyte immunoglobulin-like receptors (LILRs) are inhibitory, stimulatory or soluble receptors encoded within the leukocyte receptor complex. LILRs includes activating (LILRA1, LILRA2, LILRA3) and inhibitory (LIRB1, LILRB2, LILRB3, LILRB4, LILRB5) isoforms. LILRA1, also known as CD85i and LIR-6, is a Protein Coding gene. Among its related pathways are Innate Immune System and Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. Mature human LILRA1 consists of a 445 amino acid (aa) extracellular domain (ECD) with 4 Ig-like domains, a 21 aa transmembrane segment, and a 7 aa cytoplasmic tail. LILRA1 (LIR-6) can recognize MHC (major histocompatibility complex) class I or class I-like molecules, and high levels of sequence similarity among LILRA1, LILRA2 (ILT1), LILRA3 (ILT6) and LILRB1/B2. Among its related pathways are Innate Immune System and Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. Gene Ontology (GO) annotations related to this gene include transmembrane signaling receptor activity and antigen binding.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 8 reviews
Sort
Product Reviews
★★★★★ 5
These work!
Size: M (up to size 9)-Beige
I’ve had dry cracked feet my whole life. Tried these last night with lotion from Trader Joe’s and literally overnight my feet are the softest they’ve ever been. I put a pair of socks over them and went to sleep with them on. Hard to walk around with all that slippery-ness but worth it! 10/10✨👌
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2025
★★★★★ 5
Awesome bully sticks!
Patrick, my Border Collie, gets a 12 inch bully stick once or twice a week. He absolutely loves bully sticks more than any other treat, but I don’t! They all stink and cost a lot of money! But these Bully and Bones didn’t stink at all. So far, they’ve lasted twice as long as other bully sticks I have bought in the past. Very nice product, I’ll be buying more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
★★★★★ 5
Golden Retriever Approved!
My 8-year-old golden retriever LOVES these bully sticks! And it makes me very happy to see how much joy she gets from them. They last a long long time, and of all the brands I've tried, these are hands down the best quality and best overall value.
I also wanted to point out that this brand doesn't smell bad at all. Some of the other brands I've given her were a little stinky. She didn't care, but I really appreciate that these truly have no odor.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2026
★★★★★ 5
Long lasting - great value - great product.
Our dogs are loving these Bullysticks! At first, I thought maybe the 12” size would be too big for my smaller pups, but to my surprise, they are perfect. We can get at least 4 entertainment sessions per treat, keeping the pups happy and busy for hours. Great value/great product. Thank you Bully & Bones!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
★★★★★ 1
Dangerous Pet Product
When my dog chewed the stick it became soft and when I pulled the last 1" from my dogs mouth the stick was now a long cartilage like long rope...It wasn't like a regular Bully Sick the the dog chews for awhile..This product is a danger for Dogs...Please don't purchase..Vetinary Visit for sure after this imitation Bully Stick
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 17, 2025