SKU: 31495232370

Human TNF-β Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Oct 8 - Oct 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TNF-β Protein, His TagProduct Specification Species Human Synonyms Lymphotoxin alpha, LT alpha, TNF beta, Tumor necrosis factor ligand superfamily member 1, LTA, TNFB, TNFSF1 Accession P01374 Amino Acid Sequence Protein sequence (P01374, Leu35 Leu205, with C His Tag) LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL Expression System HEK293 Molecular

Product Specification


Species Human
Synonyms Lymphotoxin-alpha, LT-alpha, TNF-beta, Tumor necrosis factor ligand superfamily member 1, LTA, TNFB, TNFSF1
Accession P01374
Amino Acid Sequence

Protein sequence (P01374, Leu35-Leu205, with C-His Tag) LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Expression System HEK293
Molecular Weight Predicted MW: 20.3 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNF-beta, also known as Lymphotoxin-alpha (LTα), is a cytokine belonging to the tumor necrosis factor (TNF) superfamily. Its primary function involves the development and organization of secondary lymphoid organs, such as lymph nodes and spleen, during embryogenesis. In adulthood, TNF-beta is a key mediator in the maintenance of the lymphoid architecture and the initiation of inflammatory responses against pathogens. It exists in two forms: a soluble homotrimer that signals through TNF receptors 1 and 2, and a membrane-bound heterotrimer with LTβ, which signals through the LTβ receptor. Dysregulation of TNF-beta is implicated in autoimmune and chronic inflammatory diseases, making it a significant therapeutic target.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 31495232370

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kerri Campbell
Lake Worth, US
★★★★★ 5
A Great Graduation Gift
Format: Hardcover
This was one of my favorite books when I was a child. I've been purchasing this as a graduation gift for years. I gave it to both my daughters when they graduated high school and was happy to read that very copy we gifted our daughter to my granddaughter. The book has also helped me in some difficult times of my own life. Dr. Seuss is timeless and this makes a great gift.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
N
Verified Purchase
Natalie H.
Dallas, US
★★★★★ 5
The Perfect Gift for a New Beginning
Format: Hardcover
Oh, the Places You'll Go! by Dr. Seuss is a timeless and encouraging read filled with humor, wisdom, and inspiration about life’s journey and all of its ups and downs. This is such a meaningful gift for a high school senior, graduate, or anyone stepping into a new chapter of life.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
M
Verified Purchase
Maria
Carnegie, US
★★★★★ 5
I recommend using this book. Read review.
Format: Hardcover
I recommend this book. Not only because it's a Dr. Sue's book, but because at the end of the school year. I ask my son's teacher to sign it. It's a sweet memory to have and it will be a sweet memory to look at once they graduate Elementary. It's a must. The price is great. Quality... Everything about it is great. Most of all.... Reading the their teacher's have to say about them. Is so sweet!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
M
Verified Purchase
Mommy Sarah
Belleville, US
★★★★★ 5
Dr. Suess. Enough Said.
Format: Hardcover, Format: Hardcover
Welcome to the whimsical world of Dr. Seuss, where "Oh, the Places You'll Go!" isn't just a book—it's a roadmap to life's most thrilling escapades! If life were a rollercoaster, this book would be the front-row seat to the wildest ride of all. From the moment you crack open its vibrant pages, you're whisked away on an exhilarating journey filled with colorful landscapes, quirky characters, and nuggets of wisdom disguised in Seussian rhymes. It's a literary wonderland where imagination reigns supreme, and the words dance off the pages, pulling you into an adventure unlike any other. Dr. Seuss, the maestro of whimsy and wonder, takes you on a whirlwind exploration of life's ups and downs, encouraging you to embrace every twist, turn, and unexpected detour with unbridled enthusiasm. Whether you're just starting out on life's path or navigating its winding roads, this book serves as a beacon of hope, inspiration, and boundless possibilities. Now, let's talk about the humor woven into every verse—oh, it's a riot! Dr. Seuss's playful language and zany illustrations transform life's perplexities into delightful puzzles to solve. You'll find yourself chuckling at the absurdity of the situations and nodding knowingly at the profound truths hidden within the jest. And oh, the illustrations! They're a visual feast for the eyes, bursting with vibrant hues and fantastical landscapes that transport you to worlds beyond your wildest dreams. The whimsical characters and their expressions evoke emotions that range from sheer joy to contemplative reflection, leaving an indelible mark on your heart. But wait, there's more! This book isn't just for kids—it's a timeless gem that resonates with readers of all ages. Whether you're 8 or 80, the wisdom embedded in its verses speaks volumes about the human spirit's resilience, determination, and unwavering courage to conquer life's myriad challenges. In essence, "Oh, the Places You'll Go!" isn't merely a book; it's a celebration of life's rollercoaster, a symphony of laughter, and a profound reminder that the journey itself is the greatest adventure of all. So, buckle up, embrace the whimsy, and get ready to soar to unimaginable heights—you're in for an exhilarating ride! *Disclaimer: May induce spontaneous outbreaks of giggles and an insatiable thirst for adventure!*
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 15, 2023
E
Verified Purchase
Eve Allen
Dallas, US
★★★★★ 5
Oh, the places you'll go! Book Review
Format: Hardcover
Perfect hardcover book for such an affordable price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products