SKU: 31735335273

EphA6 His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 12 - Sep 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EphA6 His Tag Protein, HumanProduct Specification Species Human Antigen EphA6 Synonyms Ehk2 Protein, Hek12 Protein, m ehk2 Protein Accession Q9UF33 Amino Acid Sequence Typ23 Val550, with C terminal 10*His

Product Specification


Species Human
Antigen EphA6
Synonyms Ehk2 Protein, Hek12 Protein, m-ehk2 Protein
Accession Q9UF33
Amino Acid Sequence

Typ23-Val550, with C-terminal 10*His WPGDCSHVSNNQVVLLDTTTVLGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLFYMESDESHGIKFKPNQYTKIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGYFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDAPSLIGVVRKDWASQNSIALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIITGLKPATKYVFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQILVGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 65-73kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Gitanjali Das, Qili Yu, Ryan Hui, Kenneth Reuhl, Nicholas W. Gale & Renping Zhou Cell & Bioscience volume 6, Article number: 48 (2016).

Background

Ephrin-a receptor 6, also known as EphA6 or EHK2, belongs to the Ephrin receptor subfamily of the protein tyrosine kinase family. The Eph family is the largest group of related receptor tyrosine kinases known, consisting of 16 members in the vertebrate genome. Eph receptor and its ligand ephrin play an important role in neuronal migration, axon binding and specific target guidance, dendritic spine formation and neuroplasticity. Studies have shown that EphA5 and EphA6 are significantly expressed in perinatal development and in the cerebral cortex of adult mice, so EphA5 and EphA6 play an important role in regulating the cellular structure of cortical neurons.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 31735335273

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
George Mann
Belleville, US
★★★★★ 5
Enjoyable
Color: Grey, Size: Queen
Holds their shape and stay cool.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
R
Verified Purchase
River
Houston, US
★★★★★ 5
So comfy
Size: King (Pack of 1), Style: Standard Loft (4" - 5")
I spent time looking up/watching videos on pillows for neck pain and this one comes up a lot. I’m someone that used to wake up every few weeks with a stiff neck so bad it could make me cry at work. I haven’t had that happen once after months of using this pillow. I look forward to laying my head down on it every night. It’s a luxury experience every time. I think what it does so well is maintain its shape. You can really squish it up how you want and it stays there even after hours. Moldable but somehow still firm. It’s expensive but to me the value is there because I no longer get crazy neck pain from sleep. Worth trying it out for sure. Btw I was stuck between this is and Purple brands couple top end options. I never got around to trying them because I tried this one first and was very satisfied! Feb 2026. Still use it every night and it's still protecting me from neck pain I used to get from sleeping. It's held up amazing. Hope to use it for many more years.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2025
A
Verified Purchase
Amazon Customer
New York, US
★★★★★ 5
Saatva Pillow is great
Size: Standard/Queen (Pack of 1), Style: Standard Loft (4" - 5")
So far this is the best pillow I have had in the last 10 years and I have tried two Purple pillows a couple different memory foam and Gel pillows at least 4 more pillows that I can't even remember the names of. My neck and shoulders are almost pain free. I have also been doing more stretching of my arms which is also helping, but this pillow has really made the most difference in the pain I have had, I felt difference from the first time I put my head on it. It's comfortable, the perfect height I got the 4"-5", I also got the queen size and it's great. It supports my head just right. I also ordered the Saatva Classic 14" mattress from the company and I sure hope it's as good or better would be great because I have back issues for the last 50 years.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 16, 2025
Y
Verified Purchase
YL
New York, US
★★★★★ 1
Cotton Fluff Around a Mostly Empty Bag
Size: King (Pack of 1), Style: High Loft (6"-7")
Bought the high-loft king, thinking it would be a great (tall) side-sleeper. What I got? A very nice, completely compressible cotton outer shell wrapped around a bag a bit smaller than a standard pillow. In that bag? A tiny amount of small latex chunks, just about a third full. That’s right, some cotton fluff around a basically empty bag. Could you buy some latex yourself and add it? No, the bag is sewn shut. You could probably fill a small pillow with latex you bought elsewhere and put that in. But seriously, what did you pay Saatva for in that case? Probably as close as I’ve seen a major/high-reputation company get towards a literal example of rip off.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
P
Verified Purchase
Perry Baker
Carnegie, US
★★★★★ 3
Wrong item ships/decent pillow/price unjustified
Size: Standard/Queen (Pack of 1), Style: Standard Loft (4" - 5")
Sent me the wrong pillow twice in a row. It said high loft and standard loft on the packing, not sure what the problem is. I ordered standard loft both times, and both times they sent high loft. That name is very deceiving though. If what I have is high loft, the standard loft wouldn’t be much thicker than your standard flat down pillow. If you’d like any sort of neck support I’d suggest starting with the high loft and going down instead of the other way around. I am 5’ 7” 130lbs and this pillow does not lift my neck up further than neutral, which is a good thing. Shredded memory foam pillows are significantly higher or thicker if that helps. Pillow itself grew on me. You can definitely feel that there is a different material in the center of the pillow. I ordered it as a gift and ended up keeping both pillows. The price tag on this item is absolutely outrageous. I would have never ordered it for myself. Saatva products don’t last in my experience, we got their firmest mattress and within 2 years it was sagging horribly. I am interested to see how long this pillow lasts!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2026

recommand products