Pay in installments of $29.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 3 - Sep 8
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
GDNF Protein, HumanProduct Specification Species Human Synonyms ATF; HFB1 GDNF; HGDNF; HSCR3 Accession P39905 Amino Acid Sequence Ser78 Ile211 SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized Powder Storage Buffer
Product Specification
| Species | Human |
| Synonyms | ATF; HFB1-GDNF; HGDNF; HSCR3 |
| Accession | P39905 |
| Amino Acid Sequence | Ser78-Ile211 SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Expression System | E.coli |
| Molecular Weight | 16kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | No Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris,500mM NaCl,1mEDTA pH8.5 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage |
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Shelley J Allen (2013) Pharmacol Ther. 138(2):155-75. |
Background
GDNF and the GDNF-family ligands artemin, neurturin and persephin belong to the transforming growth factor-β (TGF-β) superfamily. The TGF-β superfamily represents a collection of multifunctional cytokines, including the neurotrophin family. Although GDNF shows only limited amino-acid sequence homology with the other members of the superfamily, it has significant conformational similarity as they all have the characteristic cysteine knot structural motif with the formation of three disulphide bonds. This family of proteins all function as homodimers and show protective and restorative effects in the developing and adult central nervous system (CNS). The neurotrophic effects of GDNF appear to be dependent on the presence of TGF-β in both in vivo and in vitro studies. GDNF was originally isolated from the supernatant of a rat glioma cell-line, and found to have pronounced effects on the survival of midbrain dopaminergic neurons. It has a relatively high specificity for dopaminergic neurons and thus has significant potential for the treatment of PD, which is predominantly characterised by progressive depletion of midbrain dopaminergic cell populations. Subsequently, GDNF has also been found to have trophic and protective effects on noradrenergic neurons in the locus coeruleus, as well as peripheral motor neurons, raising hopes for its therapeutic potential in HD and ALS.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy