SKU: 39558944038

Mouse CD69, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD69, his tagProduct Specification Species Mouse Accession P37217 Amino Acid Sequence Protein sequence (P37217, Asn62 Arg199, with C 10*His) NVGKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 17. 5 kDa Observed MW: 25 32 kDa Purity 95% by SDS PAGE Tag with C 10*His Physical Appearance Lyophilized Powder

Product Specification


Species Mouse
Accession P37217
Amino Acid Sequence

Protein sequence (P37217, Asn62-Arg199, with C-10*His) NVGKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 17.5 kDa Observed MW: 25-32 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD69 (Cluster of Differentiation 69) is a human transmembrane C-Type lectin protein encoded by the CD69 gene. It is an early activation marker that is expressed in hematopoietic stem cells, T cells, and many other cell types in the immune system. It is also implicated in T cell differentiation as well as lymphocyte retention in lymphoid organs. The activation of T lymphocytes and Natural Killer (NK) cells, both in vivo and in vitro, induces expression of CD69. This molecule, which appears to be the earliest inducible cell surface glycoprotein acquired during lymphoid activation, is involved in lymphocyte proliferation and functions as a signal-transmitting receptor in lymphocytes, including natural killer (NK) cells, and platelets.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39558944038

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Customer
Fort Morgan, US
★★★★★ 5
Super super glittery!
Color: Fairy-Diamond
Super, super glittery! I ended up returning because, believe it or not, it was too glittery for me! But it's a good product :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
S
Verified Purchase
soultwin5
Louisville, US
★★★★★ 4
Decent for the price.
Color: Rainy-Rainbow
The color is pretty, the bottle seems to be working well for now. The atomizer pump is so cute and makes me feel super dainty and girly! I love the xtra refill, the funnel and two glitter glues for makeup looks. The glue is good enough to hold the glitter but not too sticky where it leaves a nasty residue. So that’s a plus and it’s easy to wash off. However, the glitter does not adhere or stay in place on dry skin. I’m assuming it’ll be great to spray on the body if you have some type of oil in for it to adhere too but haven’t tried it yet. Will update next weekend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 7, 2026
J
Verified Purchase
Jazmin
Alexandria, US
★★★★★ 5
10/10
Color: Iridescent-Violet
I love this! It has a lot of glitter and it last a long time! It sprays smoothly and looks so good!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
S
Verified Purchase
Sassyondra
Massapequa, US
★★★★★ 5
Love it.
Color: Rainy-Rainbow
This glitter is gorgeous on. Really easy to apply, sprays evenly and a good amount at once. It wasn’t a nightmare to deal with either clinging to things it fell/rubbed onto which I was pleasantly surprised by. It cleans up very well. A little goes a long way too, so it should last a while. It stayed on my body fairly well throughout the night too. I have really sensitive skin so I was hesitant to even get glitter at all. I tried body glitter 2 years ago but it was a liquid spray kind and I broke out in an intense rash all over. I also have a chronic hive condition so my skin flares up from products due to sensitivity. I did not have ANY issues with this glitter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 19, 2025
J
Verified Purchase
Judith G.
Chelsea, US
★★★★★ 5
Absolutely Stunning Glitter with Thoughtful Packaging! | Rainy Rainbow
Color: Rainy-Rainbow, Color: Rainy-Rainbow
This glitter is breathtaking! The sparkles catch the light very beautifully — it has a mesmerizing, holographic shine that’s perfect for adding extra pizzazz to any project. When it arrived, I was pleasantly surprised at how well it was packaged. The box was securely sealed, and everything inside was perfectly intact—minor spills, no mess. A heads up on opening the entire thing: the round container’s Lid is screwed on VERY LOOSELY. Be mindful when you’re unboxing. Screw it back on very tightly. The spray nozzle on this bottle gives such a beautiful, antique perfume vibe—it really elevates the whole experience. It sprays the glitter perfectly, so it’s easy to get a flawless application every time. (Don’t forget to keep the little nozzle cover to protect it!) Honestly, I wouldn’t apply it any other way than with the bottle—it just makes everything so much smoother. 🤷🏻‍♀️ If you happen to go overboard, just grab the closest shirt and wipe off any excess. No point in wasting any of this stuff! :) Oh, & those two little gloss bottles are actually glue, which is perfect for keeping everything right where you need it to be. Here’s a little pro tip: I used the same tape that kept the box sealed to reseal the lid of the round glitter container until I’m ready to use it. Worked like a charm! 😎 It’s a small detail, but it will keep everything neat, and prevent unwanted glitter explosions in the future. If you’re a sparkle lover, you’ll adore this glitter—it’s as pretty in person as it looks online!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 16, 2024

recommand products