Pay in installments of $50.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 11 - Sep 16
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human TSH alpha/beta Heterodimer, His tagProduct Specification Species Human Synonyms Thyroid stimulating hormone subunit beta (TSH B; TSH beta), Thyrotropin beta chain, Anterior pituitary glycoprotein hormones common subunit alpha, Choriogonadotropin alpha chain, Chorionic gonadotrophin subunit alpha (CG alpha), Follicle stimulating hormone alpha chain (FSH alpha), Follitropin alpha chain Accession P01215P01222 Amino Acid Sequence Protein sequence(P01222&P01215,Phe21 Tyr132&Ala25 Ser116,
Product Specification
| Species | Human |
| Synonyms | Thyroid-stimulating hormone subunit beta (TSH-B; TSH-beta), Thyrotropin beta chain, Anterior pituitary glycoprotein hormones common subunit alpha, Choriogonadotropin alpha chain, Chorionic gonadotrophin subunit alpha (CG-alpha), Follicle-stimulating hormone alpha chain (FSH-alpha), Follitropin alpha chain |
| Accession | P01215、P01222 |
| Amino Acid Sequence | Protein sequence(P01222&P01215,Phe21-Tyr132&Ala25-Ser116, with C-10*His) FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY & APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:24.7 kDa Actual:35-70 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/mg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Thyroid stimulating hormone, beta also known as TSHB is a protein which in humans is encoded by the TSHB gene. Thyrotropin-stimulating hormone (TSH) is a noncovalently linked glycoprotein heterodimer and is part of a family of pituitary hormones containing a common alpha subunit (TSHA) and a unique beta subunit (this protein) that confers specificity. Glycoprotein hormones, alpha polypeptide is a protein that in humans is encoded by the CGA gene. The gonadotropin hormones, human chorionic gonadotropin (hCG), luteinizing hormone (LH), follicle-stimulating hormone (FSH), and thyroid-stimulating hormone (TSH) are heterodimers consisting of alpha and beta subunits (also called chains) that are associated non-covalently. The alpha subunits of these four human glycoprotein hormones are identical; however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy